DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34171 and CG30283

DIOPT Version :9

Sequence 1:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:236 Identity:67/236 - (28%)
Similarity:103/236 - (43%) Gaps:47/236 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GDNHF-CTGVILTNRHVLTSAHCITDKNGVMMSPKRIVVALCASLFKTPESEEFVVDIHNMIIHP 115
            |:..| |.|.::|||.||||||||.  ||      .:.|.| ..|.:..|:::|.||.  |.:|.
  Fly    62 GEGGFHCGGTLITNRFVLTSAHCIA--NG------ELKVRL-GVLEREAEAQKFAVDA--MFVHT 115

  Fly   116 YYHRNQHNDIAIIKLKRYVKLDGHHLAPVVLGNSSLEVGND-----CKTIGGIFGVRRQRFGS-- 173
            .|:.:|| |:|:::|.:.|.. ..:::|:.|....|....|     .:|.|  :|....|..|  
  Fly   116 DYYFDQH-DLALLRLAKRVHY-SDNISPICLLLDPLVKNIDEHIVKFRTYG--WGKTESRSSSRM 176

  Fly   174 FHSMLLVNVELRPFDECLKVKKSLMAARPE---NEDLICVKSTEKQMCTTDFGGPL-----FCDG 230
            .....|.|:..   .||.|       ..|.   |.:.||.:|.....|..|.||||     :...
  Fly   177 LQKTSLFNLHR---SECAK-------QYPHQQINRNHICAESANANTCNGDSGGPLTAIVTYDHV 231

  Fly   231 QL---YGI-ALGSINCSSPDPVFFSDVSFYNSWVTKIISEA 267
            |:   :|: :.|..:||.  ...|::|..:..|:...:..|
  Fly   232 QMVFQFGVTSFGHADCSK--ATVFTNVMTHLDWIVNTVRRA 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 65/227 (29%)
Tryp_SPc 38..263 CDD:304450 66/230 (29%)
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 65/227 (29%)
Tryp_SPc 43..266 CDD:238113 66/230 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.