DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34171 and try-9

DIOPT Version :9

Sequence 1:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001021891.1 Gene:try-9 / 3565941 WormBaseID:WBGene00023425 Length:279 Species:Caenorhabditis elegans


Alignment Length:250 Identity:49/250 - (19%)
Similarity:85/250 - (34%) Gaps:81/250 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 DNHFC---TGVILTNRHVLTSAHCITDKNGVMMSP------------------KRIVV---ALCA 93
            :|.|.   ||.:::..|::|:||.|    |:...|                  |..|.   ..||
 Worm    21 ENEFVQHGTGTLVSPWHIVTAAHLI----GISEDPLPDCDTGNLREAYFVRDYKNFVAFVNVTCA 81

  Fly    94 -----------SLFKTPESEEFVVDIHNMIIHPYY------HRNQHNDIAIIKLKRYVKLDGHHL 141
                       .:||.       :.|.::.|...|      .|...||||:.:|:..::. ...:
 Worm    82 VPEMCKGLHRKDMFKP-------LAIKSLYIRKGYVGDGCIDRESFNDIAVFELEEPIEF-SKDI 138

  Fly   142 APVVLGNSSLEVGNDCKTIGGIFGVRRQRFGSFHSMLLVNVELRPFDECLK--VKKSLMAARPEN 204
            .|..| .|:.::....:|...:||..|.                |.|..|:  ..|||.:...|.
 Worm   139 FPACL-PSAPKIPRIRETGYKLFGYGRD----------------PSDSVLESGKLKSLYSFVAEC 186

  Fly   205 ED------LICVKSTEKQM-CTTDFGGPLF--CDGQLYGIALGSINCSSPDPVFF 250
            .|      :.|..:..:.: |..|.|..:.  .|.:...:.:|.::...|.|..:
 Worm   187 SDDFPYGGVYCTSAVNRGLSCDGDSGSGVVRTSDTRNVQVLVGVLSAGMPCPELY 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 49/249 (20%)
Tryp_SPc 38..263 CDD:304450 49/249 (20%)
try-9NP_001021891.1 Tryp_SPc 30..237 CDD:389826 44/235 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.