DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34171 and CG4650

DIOPT Version :9

Sequence 1:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster


Alignment Length:257 Identity:50/257 - (19%)
Similarity:89/257 - (34%) Gaps:82/257 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 YIHTPGDNHFCTGVILTNRHVLTSAHC----------------ITDKNGVMMSPKRIVVALCASL 95
            |:||....:.|.|.::|.:.|||:|||                ..|.|..|:|..::......||
  Fly    47 YLHTSELLYVCGGTVITEKLVLTAAHCTRASEQLVARIGEFIGTDDANDTMLSEYQVSQTFIHSL 111

  Fly    96 FKTPESEEFVVDIHNMIIHPYYHRNQHNDIAIIKLKRYVKLDGHHLAPV---------------- 144
            :.|..|.                    |||||:.|...: :....:.|:                
  Fly   112 YNTTTSA--------------------NDIAILGLATDI-VFSKTIRPICIVWWTIWRKYIDNIQ 155

  Fly   145 VLGNSSLEVGNDCKTIGGIFGVRRQRFGSFHSMLLVNVELRPFDECLKVKKSLMAARPENEDLIC 209
            ||..:...:.||           |....:|.   :.::..:|.:.|..:..:.:.:     ...|
  Fly   156 VLSGAQWGLPND-----------RNESDAFR---ITDIRRQPANMCSTLNGTAILS-----SQFC 201

  Fly   210 VKSTEKQMCTTDFGGPL-----FCDGQLY---GIALGSINCSSPDPVFFSDVSFYNSWVTKI 263
            ...::.::|..||..||     |.:.|.|   |||..:..|....  .::||..:..::..:
  Fly   202 AGDSDSKLCNVDFSSPLGAIITFKNIQRYVLIGIATTNQKCKRAS--VYTDVLSHTDFILSV 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 50/252 (20%)
Tryp_SPc 38..263 CDD:304450 50/255 (20%)
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 50/252 (20%)
Tryp_SPc 33..258 CDD:304450 50/252 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436661
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.