DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34171 and Jon25Biii

DIOPT Version :9

Sequence 1:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster


Alignment Length:241 Identity:54/241 - (22%)
Similarity:94/241 - (39%) Gaps:72/241 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 FCTGVILTNRHVLTSAHCITDKNGVMMSPKRIVVALCASLFKTPESEEFVVDIHNMIIHPYYHRN 120
            :|.|.|:.:..|||:.|||.|...        |:....:.::|.......|...|.|.|      
  Fly    61 WCGGSIIAHDWVLTAEHCIGDAAS--------VIVYFGATWRTNAQFTHTVGNGNFIKH------ 111

  Fly   121 QHNDIAIIKLKRYVKLDGHHLAPVVLGNSSLEVGNDCKTIGGIFGVRRQRFGSFHS--------- 176
            .:.|||:|::..   :|..|:...|    .|...||             |:.:::.         
  Fly   112 SNADIALIRIPH---VDFWHMVNKV----ELPSYND-------------RYNNYNEWWAVACGWG 156

  Fly   177 -----------MLLVNVELRPFDECLKVKKSLMAARPENEDLICVKSTE-KQMCTTDFGGPLFC- 228
                       :..|::::...:||.....|:      .:::||.::.: |.:|..|.||||.. 
  Fly   157 GTYDGSPLPDWLQCVDLQIVHNEECGWTYGSV------GDNVICTRTVDGKSICGGDSGGPLVTH 215

  Fly   229 DG-QLYGIA--LGSINCSSPDPVFFSDVSFYNSWVTKIISEAVDHT 271
            || :|.|::  :.|..|.|..|..|..|:::..|:.       |||
  Fly   216 DGSKLVGVSNFVSSNGCQSGAPAGFQRVTYHLDWIR-------DHT 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 50/228 (22%)
Tryp_SPc 38..263 CDD:304450 51/231 (22%)
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 50/228 (22%)
Tryp_SPc 37..253 CDD:238113 51/238 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471239
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.