DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34171 and CG8952

DIOPT Version :9

Sequence 1:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster


Alignment Length:317 Identity:71/317 - (22%)
Similarity:120/317 - (37%) Gaps:95/317 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LAYFLLLKIALV----LPKNITTIKINHYHEPTYSHLSSYLVSLRTRKYIHTP---------GDN 54
            |...||..|::|    .|.|.:.|||:           :.:||....|....|         .|:
  Fly     9 LMLVLLAAISVVGQPFDPANSSPIKID-----------NRIVSGSDAKLGQFPWQVILKRDAWDD 62

  Fly    55 HFCTGVILTNRHVLTSAHCITDKNGVMMSPKRIVVALCASLFKTPESEEFVVDI----------H 109
            ..|.|.|:::..|||:|||....:.:.:            :|.|       ||:          :
  Fly    63 LLCGGSIISDTWVLTAAHCTNGLSSIFL------------MFGT-------VDLFNANALNMTSN 108

  Fly   110 NMIIHPYYHRNQHNDIAIIKLKRYVKLDGHHLAPVVLG--NSSLEVGNDCKTIGGIFGVRRQRFG 172
            |:||||.|:...:||:::|:|...:....:..|..::|  ..|::......||.| ||.....:.
  Fly   109 NIIIHPDYNDKLNNDVSLIQLPEPLTFSANIQAIQLVGQYGDSIDYVGSVATIAG-FGYTEDEYL 172

  Fly   173 SF-HSMLLVNVELRPFDECLKVKKSLMAARPENEDLICVK---STEKQMCTTDFGGPLFCDGQLY 233
            .: .::|...||:....:|:.:....:..    :..:|.|   .::...||.|.||||.    ||
  Fly   173 DYSETLLYAQVEIIDNADCVAIYGKYVVV----DSTMCAKGFDGSDMSTCTGDSGGPLI----LY 229

  Fly   234 G--------IALGSI----NCSSPDPVFFSDVSFYNSWVTKIISEAVDHTRPFIADR 278
            .        |.:.|.    .|:...|..::.||.:..               ||||:
  Fly   230 NKTIQQWQQIGINSFVAEDQCTYRLPSGYARVSSFLG---------------FIADK 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 57/267 (21%)
Tryp_SPc 38..263 CDD:304450 57/261 (22%)
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 57/273 (21%)
Tryp_SPc 38..271 CDD:238113 60/275 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471213
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.