DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34171 and CG31205

DIOPT Version :9

Sequence 1:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster


Alignment Length:230 Identity:57/230 - (24%)
Similarity:97/230 - (42%) Gaps:53/230 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 CTGVILTNRHVLTSAHCIT-DKN----GVMMSPKRIVVALCASLFKTPESEEFVVDIHNMI-IHP 115
            |||:::.:|.|:|:|||:: |::    ||:..                :|:...:::.:.: :||
  Fly    68 CTGILIDSRRVVTAAHCVSKDESESIYGVVFG----------------DSDSSNINLVSAVTVHP 116

  Fly   116 -YYHRNQHNDIAIIKLKRYVKLDGHHLAPVVLGNSS-----LEVGNDCKTIGGIFGV---RR--- 168
             |..|...||:|||:|.:.| :....:.|:.|.:.|     .|..|....:.|:.|.   ||   
  Fly   117 DYSPRKFENDLAIIELTKEV-VFSDLVQPICLPSVSEMVPGSETSNSKLIVAGLEGPSFDRRHSA 180

  Fly   169 -QRFGSFHSMLLVNVELRPFDECLKVKKSLMAARPENEDLICVKSTEK-----QMCTTDFGGPLF 227
             ||......|....::.:   ||    ....|..|  |:||| ..||:     ...|...|.|. 
  Fly   181 TQRLDKRIKMTYTKIDSK---EC----HEKQARFP--EELIC-GHTERSPLSGSALTEASGTPR- 234

  Fly   228 CDGQLYGIALGSINCSSPDPVFFSDVSFYNSWVTK 262
             ...|.|||:.....|..|...:.::..:..|::|
  Fly   235 -QFHLLGIAVAGFFSSDLDHQGYLNIRPHLDWISK 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 55/226 (24%)
Tryp_SPc 38..263 CDD:304450 57/230 (25%)
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 29/116 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.