DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34171 and Mcpt2

DIOPT Version :9

Sequence 1:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_742041.1 Gene:Mcpt2 / 29266 RGDID:621058 Length:247 Species:Rattus norvegicus


Alignment Length:276 Identity:79/276 - (28%)
Similarity:119/276 - (43%) Gaps:52/276 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLKIALVLPKN------ITTIKINHYHEPTYSHLSSYLVSLRTRKYIHTPGDNHFCTGVILTNR 65
            ||..:||:||..      |..::...:..|..:||     .:.|.|     |....|.|.:::.:
  Rat     4 LLFLMALLLPSGAGAEEIIGGVESIPHSRPYMAHL-----DIVTEK-----GLRVICGGFLISRQ 58

  Fly    66 HVLTSAHCITDKNGVMMSPKRIVVALCASLFKTPESEEFVVDIHNMIIHPYYHR--NQHNDIAII 128
            .|||:|||         ..:.|.|.|.|...:..||.:..:.:...|||..|:.  |.| ||.::
  Rat    59 FVLTAAHC---------KGREITVILGAHDVRKRESTQQKIKVEKQIIHESYNSVPNLH-DIMLL 113

  Fly   129 KLKRYVKL-DGHHLAPVVLGNSSLEVGNDCKTIG-GIFGVRRQRFGSFHSMLLVNVELRPFDE-- 189
            ||::.|:| ...::.|:...:..:..|..|...| |..|||...     |..|..||||..||  
  Rat   114 KLEKKVELTPAVNVVPLPSPSDFIHPGAMCWAAGWGKTGVRDPT-----SYTLREVELRIMDEKA 173

  Fly   190 CLKVKKSLMAARPENEDLICVKS--TEKQMCTTDFGGPLFCDGQLYGIALGSINCSSPD---PVF 249
            |:..:..      |.:..:||.|  |.:.....|.||||.|.|..:||    ::...||   |..
  Rat   174 CVDYRYY------EYKFQVCVGSPTTLRAAFMGDSGGPLLCAGVAHGI----VSYGHPDAKPPAI 228

  Fly   250 FSDVSFYNSWVTKIIS 265
            |:.||.|..|:..:|:
  Rat   229 FTRVSTYVPWINAVIN 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 70/241 (29%)
Tryp_SPc 38..263 CDD:304450 68/235 (29%)
Mcpt2NP_742041.1 Tryp_SPc 20..239 CDD:214473 71/253 (28%)
Tryp_SPc 21..242 CDD:238113 72/255 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.