DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34171 and CG18636

DIOPT Version :9

Sequence 1:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster


Alignment Length:288 Identity:68/288 - (23%)
Similarity:110/288 - (38%) Gaps:91/288 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 TTIKINHYHEPTYSHLSSYLVSLRTRKYIHTPGDNHFCTGVILTNRHVLTSAHCITDKNGVMMSP 84
            |..:|.:.|...|:. |.::|      ::|:..|...|.|.::|::.|||:|||       .::.
  Fly    41 TAYRIINGHTAKYNS-SPWMV------FLHSTTDMFVCGGSLITDKLVLTAAHC-------FIAN 91

  Fly    85 KRIVVAL----------CASLFKTPESEEFVVDIHNMIIHPYYHRNQH-NDIAIIKL-KRYVKLD 137
            :.:|..|          |...: ....||.:||..  ..|..|..|.| |||||::| |..|..|
  Fly    92 QHLVARLGEYERTRSEECTGYY-CNFREEHMVDAG--FKHKLYDPNTHANDIAILRLSKSVVYRD 153

  Fly   138 G-------------HHLAPVVL------GNSSLEVGNDC-KTIGGIFGVRRQRFGSFHSMLLVNV 182
            .             |:|..:.|      |.:.:|..:|. :|:    .:|||             
  Fly   154 NIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQTL----DIRRQ------------- 201

  Fly   183 ELRPFDECLKVKKSLMAARPENEDLICVKSTEKQMCTTDFGGPLFCDGQL-----------YGIA 236
               |.|.|.|.....:|.     :..|..:.:..:|..|.||||   |.:           .|||
  Fly   202 ---PPDVCAKFIGQTIAG-----NQFCAGNWDSNLCNGDSGGPL---GAVITHKNTQRFVQVGIA 255

  Fly   237 -LGSINCSSPDPVFFSDVSFYNSWVTKI 263
             ..:.||....  .|:||..:..::.::
  Fly   256 SYTNRNCQKAS--VFTDVLSHAEFILRV 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 65/274 (24%)
Tryp_SPc 38..263 CDD:304450 63/268 (24%)
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 67/280 (24%)
Tryp_SPc 45..278 CDD:238113 67/279 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436660
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.