DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34171 and CG33461

DIOPT Version :9

Sequence 1:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster


Alignment Length:321 Identity:67/321 - (20%)
Similarity:125/321 - (38%) Gaps:105/321 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LLAYFLLLKIAL-------------VLPK------NITTIKINHY------HEPTYSHLSSYLVS 41
            ::||..|..:.:             |:|:      |.|..::..|      |.|||         
  Fly     9 IIAYLALFVLGVHGSSSVFLEENCGVVPRLSYKIINGTPARLGRYPWMAFLHTPTY--------- 64

  Fly    42 LRTRKYIHTPGDNHFCTGVILTNRHVLTSAHCITD-------------KNGVMMSPKRIVVALCA 93
                         ..|.|.::....||||||||.|             .|.:.....|.:.|   
  Fly    65 -------------FLCAGSLINQWFVLTSAHCIEDDVELIARLGENNRDNDIDCENNRCLEA--- 113

  Fly    94 SLFKTPESEEFVVDI---HNMIIHPYYHRNQHNDIAIIKLKRYVKLDGHHLAPV-VLGNSSLEVG 154
                   ::|:.||:   |.:    |..::..|||.:::|:|.|:.. :|:.|: :..:..:::.
  Fly   114 -------TQEYNVDMLFKHRL----YDPKDFSNDIGMLRLERRVEYT-YHIQPICIFHHRRMQLV 166

  Fly   155 ND----CKTIGGIFGVRRQRFGSFHSMLLVNVEL--RPFDECLKV-KKSLMAARPENEDLICVKS 212
            .|    .|..|  :|:......:..|.:|:.:.|  ||.::|.:: |::.::.:      ||..:
  Fly   167 VDQITWFKATG--WGLTSTDLNTKSSRVLMELNLYRRPRNDCARIFKQNFLSGQ------ICAGN 223

  Fly   213 TEKQMCTTDFGGP------LFCDGQLYGIALGSI---NCSSPDPVFFSDVSFYNSWVTKII 264
            .:..:|..|.|||      :|...:...:.:.|.   |||...  ..:||..|..|:.|::
  Fly   224 DDGNLCRGDSGGPQGRYVLIFGMKRFVQMGIASFTYENCSKVS--ILTDVVRYGRWIKKVV 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 56/263 (21%)
Tryp_SPc 38..263 CDD:304450 54/257 (21%)
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 60/283 (21%)
Tryp_SPc 42..281 CDD:238113 61/285 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436670
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.