DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34171 and Klk8

DIOPT Version :9

Sequence 1:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001311327.1 Gene:Klk8 / 259277 MGIID:1343327 Length:260 Species:Mus musculus


Alignment Length:219 Identity:59/219 - (26%)
Similarity:100/219 - (45%) Gaps:25/219 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GDNHFCTGVILTNRHVLTSAHCITDKNGVMMSPKRIVVALCASLFKTPESEEFVVDIHNMIIHPY 116
            |:...|.||::.:|.|||:|||...|..|.:....:         ::.:..|..:.:...|.||.
Mouse    53 GERLICGGVLVGDRWVLTAAHCKKQKYSVRLGDHSL---------QSRDQPEQEIQVAQSIQHPC 108

  Fly   117 YH----RNQHNDIAIIKLKRYVKLDGHHLAPVVLGNSSLEVGNDCKTIG-GIFGVRRQRFGSFHS 176
            |:    .:..:||.:|:|:....| |..:.||.|.|...:||..|...| |.....::.|.  ::
Mouse   109 YNNSNPEDHSHDIMLIRLQNSANL-GDKVKPVQLANLCPKVGQKCIISGWGTVTSPQENFP--NT 170

  Fly   177 MLLVNVELRPFDECLKVKKSLMAARPENEDLICVKSTE-KQMCTTDFGGPLFCDGQLYGI-ALGS 239
            :....|::...::|.:.....:     .|.::|..|:. ...|..|.||||.|||.|.|| :.||
Mouse   171 LNCAEVKIYSQNKCERAYPGKI-----TEGMVCAGSSNGADTCQGDSGGPLVCDGMLQGITSWGS 230

  Fly   240 INCSSPD-PVFFSDVSFYNSWVTK 262
            ..|..|: |..::.:..|.:|:.|
Mouse   231 DPCGKPEKPGVYTKICRYTTWIKK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 57/215 (27%)
Tryp_SPc 38..263 CDD:304450 59/219 (27%)
Klk8NP_001311327.1 Tryp_SPc 32..252 CDD:214473 57/215 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.