DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34171 and Klk1c2

DIOPT Version :9

Sequence 1:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_036809.1 Gene:Klk1c2 / 24841 RGDID:3888 Length:259 Species:Rattus norvegicus


Alignment Length:241 Identity:58/241 - (24%)
Similarity:98/241 - (40%) Gaps:54/241 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 DNHFCTGVILTNRHVLTSAHCITDKNGVMMSPKRIVVALCASLFKTPESEEFVVD--IHNMIIHP 115
            :.:.|.||::....|:|:|||.::...|::...        :|||   .|.|...  :.....||
  Rat    44 NEYLCGGVLIDPSWVITAAHCYSNNYQVLLGRN--------NLFK---DEPFAQRRLVRQSFRHP 97

  Fly   116 YY-------------HRNQHNDIAIIKLKRYVKLDGHHLAPVVLGNSSLEVGNDCKTIGGIFGVR 167
            .|             | :..||:.::.|.....:.| .:..:.|.....:||:.|...|      
  Rat    98 DYIPLIVTNDTEQPVH-DHSNDLMLLHLSEPADITG-GVKVIDLPTKEPKVGSTCLASG------ 154

  Fly   168 RQRFGS--------FHSMLLVNVELRPFDECLKVKKSLMAARPENEDLICVKSTE--KQMCTTDF 222
               :||        .|.:..||:.|...::|::..|..:     .:.::|....|  |..|..|.
  Rat   155 ---WGSTNPSEMVVSHDLQCVNIHLLSNEKCIETYKDNV-----TDVMLCAGEMEGGKDTCAGDS 211

  Fly   223 GGPLFCDGQLYGIALGSIN-CSSP-DPVFFSDVSFYNSWVTKIISE 266
            ||||.|||.|.||..|... |:.| .|..::.:..:.||:.|::.|
  Rat   212 GGPLICDGVLQGITSGGATPCAKPKTPAIYAKLIKFTSWIKKVMKE 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 55/233 (24%)
Tryp_SPc 38..263 CDD:304450 56/236 (24%)
Klk1c2NP_036809.1 Tryp_SPc 24..251 CDD:214473 55/233 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.