DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34171 and CG30323

DIOPT Version :9

Sequence 1:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:320 Identity:72/320 - (22%)
Similarity:120/320 - (37%) Gaps:98/320 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 NHYHEPTYSHLSSYLVSLRTRKYIHTPGDNHFCTGVILTNRHVLTSAHCITDKNGVMMSPKRIVV 89
            ::||:        .:||:||||:|...||||||.|.:|:...|:||..|::.:            
  Fly    30 DNYHQ--------NVVSIRTRKHIRHWGDNHFCAGSLLSAWWVVTSGCCVSTR------------ 74

  Fly    90 ALCASLFKTPESEEFVVDIHNMIIHPYYHRNQHNDIAII----KLKRYVKLDGHHLAPVVLGNSS 150
                     |||.            |....|:.|...::    :||:....:.:|:..:||..|:
  Fly    75 ---------PEST------------PNQPSNRKNLRVVVFTPKRLKKPSPKNIYHVQKIVLDESA 118

  Fly   151 LEVGNDCKTIGGIFGVRRQRFGSFHSMLLVNVELR------------------------------ 185
            :....:...:....||..|||    :|:|...||.                              
  Fly   119 ISGCTELALLKLDRGVTGQRF----AMMLPEKELNSTWLCNSLGWGRIYYVSYVYISAMCPAFSM 179

  Fly   186 ------------PF-DECLKV---KKSLMAARPENEDLICVKS--TEKQMCTTDFGGPLFCDGQL 232
                        |: .|.:::   |.|....:|:....:|:.|  ....||..|.|.|||||..|
  Fly   180 VYDNPVTWFQDGPYSSELIQIRAQKISEYECKPDCSRCLCMTSYTGRGNMCQQDLGSPLFCDHFL 244

  Fly   233 YGIALGSINCSSPDPVFFSDVSFYNSWVTKIISEAVDHTRPFIADRFSLFSFIILMLSIV 292
            ||:|.....|.....:|::::.....::...:|.|....| .:..|..|...::..||:|
  Fly   245 YGVARRVHTCDDEGFMFYTNIYQNRKFIEDTLSGATWPKR-VLCFRLLLLLLVLASLSVV 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 62/282 (22%)
Tryp_SPc 38..263 CDD:304450 62/276 (22%)
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 56/266 (21%)
Tryp_SPc 45..272 CDD:214473 56/263 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471175
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008551
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.