DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34171 and CG30286

DIOPT Version :9

Sequence 1:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:303 Identity:66/303 - (21%)
Similarity:124/303 - (40%) Gaps:73/303 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YFLLLKIALVLPKNITTIKINHYH------EPTYSHLS----------SYLVSLRTRKYIHTPGD 53
            |::||         :|::...|.|      ||...::|          :::.......|:|..|:
  Fly     2 YWILL---------LTSLLPWHPHATAQFLEPDCGYMSPEALQNEEHQAHISESPWMAYLHKSGE 57

  Fly    54 NHFCTGVILTNRHVLTSAHCI-TDKN-GVMMSPKRIVVAL-CASLFKTPESEEFVVDIHNMIIHP 115
             ..|.|.::.:|.:||:|||| .|:| .|.:.....:.:: |......|.||:|.:|:  ...|.
  Fly    58 -LVCGGTLVNHRFILTAAHCIREDENLTVRLGEFNSLTSIDCNGSDCLPPSEDFEIDV--AFRHG 119

  Fly   116 YYHR-NQHNDIAIIKLKRYVKLDGHHLAPV-VLGNSSLEVGNDCKTIGGIFGVRRQRFGSFHSML 178
            .|.| |:.:||.:::|.:.|:.. .|:.|: ::.|::|:                .:....|.::
  Fly   120 GYSRTNRIHDIGLLRLAKSVEYK-VHIKPICLITNTTLQ----------------PKIERLHRLV 167

  Fly   179 LVNVELRPFDECLKVKKSLMAAR------------PENEDLICVKSTEKQMCTTDFGGP----LF 227
            .......|.:....:.||:...|            ....|.|||.......|:.|.|||    :.
  Fly   168 ATGWGRSPSEAANHILKSIRVTRVNWGVCSKTYWVDRRRDQICVSHESGVSCSGDSGGPMGQAIR 232

  Fly   228 CDGQLYGIALGSIN-----CSSPDPVFFSDVSFYNSWVTKIIS 265
            .||::..:.:|.::     |.||.  .|::|..:..|:...:|
  Fly   233 LDGRVLFVQVGIVSYGNAECLSPS--VFTNVMEHIDWIMAALS 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 58/266 (22%)
Tryp_SPc 38..263 CDD:304450 56/250 (22%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 56/251 (22%)
Tryp_SPc 39..268 CDD:214473 55/250 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436665
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.