DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34171 and CG30187

DIOPT Version :9

Sequence 1:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:277 Identity:69/277 - (24%)
Similarity:109/277 - (39%) Gaps:56/277 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 IKINHYHEPTYSHLSSYLVSLRTRKYIHTPGDNHF-CTGVILTNRHVLTSAHCITDKNGVMMSPK 85
            :||...|...:.: |.::.::..|        .|| |.|.::..|.|||:||||.|::  :.|  
  Fly    34 LKITGGHNAAFQN-SVWMAAVHNR--------THFICGGTLIHKRFVLTAAHCIVDQD--VQS-- 85

  Fly    86 RIVVALCASLFKTPESEEFVVDIHNMIIHPYY--HRNQHNDIAIIKLKRYVKLDGHHLAP--VVL 146
               |:|.|.....|...:   |:...::|..:  ..:..|||.::||...|..:. .:.|  :||
  Fly    86 ---VSLGAYNKSDPADRK---DVITAVVHSSFDVRASYENDIGLLKLSSDVIFNA-LIRPICIVL 143

  Fly   147 GNSSLEVGNDCKTIGGIFGVRRQRFGSFHSMLLVNVELRPFD--EC---LKVKKSLMAARPENED 206
            ..|......:.:|... ||....| |:..|.:|..:.|...|  ||   |.|..|        |.
  Fly   144 NKSMANHMRNMRTFKA-FGWGTLR-GNKTSDILQTIILNHLDREECYMELSVYPS--------EK 198

  Fly   207 LICVKSTEKQMCTTDFGGPLFCDGQLYG----------IALGSINCSSPDPVFFSDVSFYNSWVT 261
            .||........|..|.||||..|..:.|          |::|..:|....  .::|:..:..|:.
  Fly   199 QICAGVPSGDTCGGDSGGPLTNDVFIQGIGNREVQFGIISVGKTSCDGQG--VYTDLMSFADWIK 261

  Fly   262 KIIS----EAVDHTRPF 274
            ..|.    |....:.||
  Fly   262 MTIERLSIEDEPQSAPF 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 61/250 (24%)
Tryp_SPc 38..263 CDD:304450 61/244 (25%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 64/256 (25%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.