DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34171 and CG30088

DIOPT Version :9

Sequence 1:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster


Alignment Length:288 Identity:68/288 - (23%)
Similarity:113/288 - (39%) Gaps:64/288 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AYFLLLKIALVLPKNITTIKINHYHEPTYSHLSSYLVSLRTRKYIHTPGDNHFCTGVILTNRHVL 68
            |.||:....:....|:.| :|....|       :.|.|.....|::...:.| |.|.|:::|::|
  Fly    26 ANFLIPSCGVSYESNVAT-RIVRGKE-------AMLKSAPFMAYLYYSSEIH-CGGTIISSRYIL 81

  Fly    69 TSAHCI-------TDKNGVMMSPKRIVVALCASLFKTPESEEFVVDIHNMIIHPYYHRNQHNDIA 126
            |:|||:       ..::.:..:|.      |.....:|.:|||  ||.....:..:.|...||||
  Fly    82 TAAHCMRPYLKVRLGEHDITRNPD------CQGGSCSPPAEEF--DIVLATKYKRFDRFLANDIA 138

  Fly   127 IIKLKRYVKLDGHHLAPVVLGNSSLEVGNDCKTIGGIFGVRRQRFGSF--------HSM-LLVNV 182
            ::||.|.::.: .|:.|:            |..:..........|.:|        ||. :|...
  Fly   139 LLKLSRNIRFN-VHIQPI------------CLILNPAAAPNVHEFQAFGWGQTETNHSANVLQTT 190

  Fly   183 ELRPFD--ECLKVKKSLMAARPENEDLICVKSTEKQMCTTDFGGPLFC----DG-----QLYGIA 236
            .|..:|  .|..|     .:.|...:.:||.......|:.|.||||..    ||     ||..::
  Fly   191 VLTRYDNRHCRSV-----LSMPITINQLCVGFQGSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVS 250

  Fly   237 LGSINCSSPDPVFFSDVSFYNSWVTKII 264
            .|...|.||.  .::.|..|..|:..::
  Fly   251 FGDDKCQSPG--VYTYVPNYIRWIRYVM 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 61/257 (24%)
Tryp_SPc 38..263 CDD:304450 61/251 (24%)
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 62/263 (24%)
Tryp_SPc 45..273 CDD:238113 63/263 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436666
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.