DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34171 and CG30087

DIOPT Version :9

Sequence 1:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:227 Identity:66/227 - (29%)
Similarity:103/227 - (45%) Gaps:42/227 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 CTGVILTNRHVLTSAHCI-------TDKNGVMMSPKRIVVALCASLFKTPESEEFVVDIHNMIIH 114
            |.|.||.:|::||:|||:       ..::.:...|.      |.....:|.|||:  .|...|.|
  Fly    67 CGGSILNSRYILTAAHCVFPNLRLRLGEHNIRTDPD------CQGSNCSPRSEEY--GIMKAITH 123

  Fly   115 PYYHRNQH-NDIAIIKLKRYVKLDGHHLAP--VVLGNSSLEVGNDCKTIGGIFGVRRQRFGSFHS 176
            .:|:...| ||||::||.|.:..: .|:.|  ::|..:|.......:|.|  :|..::. |..| 
  Fly   124 RFYNAANHVNDIALLKLNRSINFN-VHIQPICILLNPASAPSVATYQTFG--WGETKKN-GFPH- 183

  Fly   177 MLLVNVELRPFDE--CLKVKKSLMAARPENEDLICVKSTEKQMCTTDFGGPLFC----DG----- 230
             ||...|||.:|.  |.:...:.|     |.:.||....|:..|..|.||||..    ||     
  Fly   184 -LLQTAELRAYDAAYCSRSFHAYM-----NGNQICAGHEERDTCAGDSGGPLVTRVDFDGVKRYL 242

  Fly   231 QLYGIALGSINCSSPDPVFFSDVSFYNSWVTK 262
            ||..::.|..:|.||.  .::.|..|.:|:.:
  Fly   243 QLGIVSYGPTDCQSPG--VYTYVPNYINWIRR 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 65/223 (29%)
Tryp_SPc 38..263 CDD:304450 66/227 (29%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 65/223 (29%)
Tryp_SPc 42..272 CDD:238113 66/225 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436667
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.