DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34171 and CG30082

DIOPT Version :9

Sequence 1:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster


Alignment Length:290 Identity:73/290 - (25%)
Similarity:116/290 - (40%) Gaps:69/290 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LKIALVLPKNITTIKINHYHEPTYSHLSSYLVSLRTR--------KYIHTPGDNHFCTGVILTNR 65
            |:...:.|...|||.:    .||     :.:|..||.        .|:| ...:..|||.::|.|
  Fly    19 LRAQFIDPNCGTTINL----PPT-----NRIVGGRTADIGSNPWLAYLH-KNSSLVCTGTLITKR 73

  Fly    66 HVLTSAHC------ITDKNGVMMSPKRIVVALCASLFKTPESEEFVVDIHNMIIHPYY--HRNQH 122
            .|||:|||      :|.:.|...:..||.   |.|.|..|..||:.|:  |..||.::  .::..
  Fly    74 FVLTAAHCLHSFHLLTVRLGEYDTSTRID---CTSEFCIPTYEEYSVE--NAYIHTFFGGRQDSR 133

  Fly   123 NDIAIIKLKRYV--KLDGHHLAPVVLGNSSLEV--GNDCKTIGGIFGVRRQRFGSFH----SMLL 179
            |||.::||...|  ||   .:.|:.|.....:|  .:..:..|         :|...    :.:|
  Fly   134 NDIGLLKLNGTVVYKL---FIRPICLFRDPGQVPYSSTYEAAG---------WGKIDLINTATVL 186

  Fly   180 VNVELRPFD--ECLKVKKSLMAARPENEDLICVKSTEKQMCTTDFGGPL---FCDG------QLY 233
            ..|.|...|  :|   ::||..:....:  .|........|:.|.||||   ..:|      ||.
  Fly   187 QTVNLIRLDQSDC---ERSLRTSLSYGQ--FCAGQWRADTCSGDSGGPLSRKMSNGRITRTVQLG 246

  Fly   234 GIALGSINCSSPDPVFFSDVSFYNSWVTKI 263
            .::.|...|..|.  .::.|..:.:|:..|
  Fly   247 IVSYGHYLCRGPG--VYTYVPSFTNWILSI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 66/265 (25%)
Tryp_SPc 38..263 CDD:304450 65/259 (25%)
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 64/256 (25%)
Tryp_SPc 40..274 CDD:238113 65/258 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436668
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.