DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34171 and T22A3.6

DIOPT Version :9

Sequence 1:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_492773.3 Gene:T22A3.6 / 188711 WormBaseID:WBGene00011909 Length:491 Species:Caenorhabditis elegans


Alignment Length:100 Identity:25/100 - (25%)
Similarity:37/100 - (37%) Gaps:20/100 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 CKTIGGIFGV-RRQRFGSFHSMLLVNVELRPFDECLKVKKSLMAARPENEDLICVKSTEKQMCTT 220
            |..:.|:..| ..:.|....|...|||.:.  |:|        ....|:|.:...::.    ..:
 Worm     8 CLILTGLVNVFLTKSFTRTFSQKFVNVSIS--DDC--------ETTEESERIFGYRTN----FYS 58

  Fly   221 DFGGPLFCDGQLYGIALGSINCSSPDPVFFSDVSF 255
            |..|.:||    :....|||..||... ||.|..|
 Worm    59 DDTGNVFC----FRKKDGSIRMSSTSR-FFEDPRF 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 24/99 (24%)
Tryp_SPc 38..263 CDD:304450 24/99 (24%)
T22A3.6NP_492773.3 KR 98..173 CDD:350900
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.