DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34171 and try-4

DIOPT Version :9

Sequence 1:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_508030.4 Gene:try-4 / 185148 WormBaseID:WBGene00006622 Length:324 Species:Caenorhabditis elegans


Alignment Length:253 Identity:48/253 - (18%)
Similarity:90/253 - (35%) Gaps:69/253 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 GVILTNRHVLTSAHCITDKNGVMMSPKRIVVALCASL-FKTPESE-----EFVVD---------- 107
            |.|::..|::|:||......|...:       ||.:. :|.|.|.     :|:.|          
 Worm    74 GSIISPYHIITAAHGFITTIGSRGN-------LCENKNWKKPNSSIYRSIKFLRDTRKVAYGGTC 131

  Fly   108 -------------------IHN-----MIIHPYYHRN--QHNDIAIIKLKRYVKLDGHHLAPVVL 146
                               |||     ::...:...|  :.:|.||:::::.:.. ..::.|:.|
 Worm   132 IRGHTDKYPNDPRCKKSDVIHNKVRAVLVDGEFASSNCLKGHDWAIVEVEKRIHF-SENVRPICL 195

  Fly   147 GNSSLEVGNDCKTIGGIFGVRRQRFGSFHSMLLVNVELRPFDECLKVKKSLMAARPENEDLICVK 211
            ...::..   .|:: .:.|..|....:....|:..:.:|...:|.:.....:.|  :.:|.||..
 Worm   196 PRPNMYY---TKSL-AVPGWGRSYIFNESGPLIHEIPMRIDRDCKRPWSDRLPA--DADDFICAT 254

  Fly   212 S------TEKQMCTTDFGGPLFCDGQLYGIA-------LGSINCSSPDPVFFSDVSFY 256
            |      :..:.|..|.||.|......||.|       .|:..|.|.....|:.|..|
 Worm   255 SMNVSNYSAPRTCHGDSGGGLEYRDDNYGRAFLIAITSFGTRGCPSNMLARFTRVDMY 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 48/253 (19%)
Tryp_SPc 38..263 CDD:304450 48/253 (19%)
try-4NP_508030.4 Tryp_SPc 51..318 CDD:238113 48/253 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.