DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34171 and CFD

DIOPT Version :9

Sequence 1:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001304264.1 Gene:CFD / 1675 HGNCID:2771 Length:260 Species:Homo sapiens


Alignment Length:244 Identity:58/244 - (23%)
Similarity:104/244 - (42%) Gaps:35/244 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SHLSSYLVSLRTRKYIHTPGDNHFCTGVILTNRHVLTSAHCITDKNGVMMSPKRIVVALCASLFK 97
            :|...|:.|::.       ...|.|.||::..:.||::|||:.|     .:..::.|.|.|....
Human    41 AHARPYMASVQL-------NGAHLCGGVLVAEQWVLSAAHCLED-----AADGKVQVLLGAHSLS 93

  Fly    98 TPESEEFVVDIHNMIIHPYYHRNQ-HNDIAIIKLKRYVKLDGHHLAPVVLGNSSLEV--GNDCKT 159
            .||..:.:.|:...:.||....:. .:|:.:::|.....| |..:.|:.......:|  |..|..
Human    94 QPEPSKRLYDVLRAVPHPDSQPDTIDHDLLLLQLSEKATL-GPAVRPLPWQRVDRDVAPGTLCDV 157

  Fly   160 IG-GIFGVRRQRFGSFHSMLLVNVELRPFDECLKVKKSLMAARPEN-----EDLICVKSTEKQMC 218
            .| ||.....:|..|...:||..::           ::....|..:     |.|:|.:|..:..|
Human   158 AGWGIVNHAGRRPDSLQHVLLPVLD-----------RATCNRRTHHDGAITERLMCAESNRRDSC 211

  Fly   219 TTDFGGPLFCDGQLYGIAL-GSINCSS-PDPVFFSDVSFYNSWVTKIIS 265
            ..|.||||.|.|.|.|:.. ||..|.: ..|..::.|:.|.:|:..:::
Human   212 KGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTRVASYAAWIDSVLA 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 57/237 (24%)
Tryp_SPc 38..263 CDD:304450 57/235 (24%)
CFDNP_001304264.1 Tryp_SPc 32..255 CDD:214473 57/237 (24%)
Tryp_SPc 33..258 CDD:238113 58/240 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.