DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34171 and Klk1b5

DIOPT Version :9

Sequence 1:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_032482.1 Gene:Klk1b5 / 16622 MGIID:892020 Length:261 Species:Mus musculus


Alignment Length:236 Identity:60/236 - (25%)
Similarity:105/236 - (44%) Gaps:52/236 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 CTGVILTNRHVLTSAHCITDKNGVMMSPKRIVVALCASLFKTPESEEFVVDIHNMIIHPYYHR-- 119
            |.||:|....|||:|||..||..|.:...        :.|:...|.:..: :...|.||.::.  
Mouse    50 CGGVLLNANWVLTAAHCHNDKYQVWLGKN--------NFFEDEPSAQHRL-VSKAIPHPDFNMSL 105

  Fly   120 -NQH---------NDIAIIKLKRYVKLDGHHLAPVVLGNSSLEVGNDCKTIGGIFGVRRQRFGSF 174
             |:|         ||:.:::||:...:. ..:.|:.|.....::|:.|...|         :||.
Mouse   106 LNEHTPQPEDDYSNDLMLLRLKKPADIT-DVVKPIDLPTEEPKLGSTCLASG---------WGSI 160

  Fly   175 HSML--------LVNVELRPFDECLK--VKKSLMAARPENEDLICVKSTE--KQMCTTDFGGPLF 227
            ..::        .||.:|.|.::|:|  ::|       ..:.::|....:  |..|..|.||||.
Mouse   161 TPVIYEPADDLQCVNFKLLPNEDCVKAHIEK-------VTDVMLCAGDMDGGKDTCMGDSGGPLI 218

  Fly   228 CDGQLYGI-ALGSINCSSPD-PVFFSDVSFYNSWVTKIISE 266
            |||.|:|| :.|...|..|: |..::.:..:|||:...|::
Mouse   219 CDGVLHGITSWGPSPCGKPNVPGIYTKLIKFNSWIKDTIAK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 58/228 (25%)
Tryp_SPc 38..263 CDD:304450 59/231 (26%)
Klk1b5NP_032482.1 Tryp_SPc 24..253 CDD:214473 58/228 (25%)
Tryp_SPc 25..256 CDD:238113 59/231 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.