DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34171 and Gzma

DIOPT Version :9

Sequence 1:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_034500.1 Gene:Gzma / 14938 MGIID:109266 Length:260 Species:Mus musculus


Alignment Length:259 Identity:61/259 - (23%)
Similarity:103/259 - (39%) Gaps:60/259 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 HLSSYLVSLRTRKYIHTPGDNHFCTGVILTNRHVLTSAHCITDKNGVMMSPKRIVVALCASLFKT 98
            |...|:..|:.       ..|..|.|.::....|||:|||...|..     |.|:.|  .|:.|.
Mouse    38 HSRPYMALLKL-------SSNTICAGALIEKNWVLTAAHCNVGKRS-----KFILGA--HSINKE 88

  Fly    99 PESEEFVVDIHNMIIHPYYHR-NQHNDIAIIKLKRYVKLDGH----HLAPVVLGNSSLEVGNDCK 158
            ||.:  ::.:.....:|.|.. .:..|:.:::||:...::.:    ||..   ....::.|..|:
Mouse    89 PEQQ--ILTVKKAFPYPCYDEYTREGDLQLVRLKKKATVNRNVAILHLPK---KGDDVKPGTRCR 148

  Fly   159 TIGGIFGVRRQRFGSFHSMLLVNVELRPFDECLKVKKSLMAARPENED------------LICVK 211
            ..|  :|    |||:         :..|.:...:|..:::..:..|::            :||..
Mouse   149 VAG--WG----RFGN---------KSAPSETLREVNITVIDRKICNDEKHYNFHPVIGLNMICAG 198

  Fly   212 STE--KQMCTTDFGGPLFCDGQLYGI-ALGSINCSS---PDP-VFFSDVSFYNSWVTKIISEAV 268
            ...  |..|..|.|.||.|||.|.|| :.|...|..   |.. .|.||.  :.:|:.||:..:|
Mouse   199 DLRGGKDSCNGDSGSPLLCDGILRGITSFGGEKCGDRRWPGVYTFLSDK--HLNWIKKIMKGSV 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 57/249 (23%)
Tryp_SPc 38..263 CDD:304450 57/248 (23%)
GzmaNP_034500.1 Tryp_SPc 28..252 CDD:214473 57/249 (23%)
Tryp_SPc 29..255 CDD:238113 58/252 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.