DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34171 and CG43742

DIOPT Version :9

Sequence 1:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:292 Identity:68/292 - (23%)
Similarity:128/292 - (43%) Gaps:58/292 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LLAYFLLLKIALVLPKNI------------TTIKINHYHEPTYSHLSSYLVSLRTRKYIHTPGDN 54
            :..:|.||.:|:|:.:|.            .|.::.:.|....|...:.|.:          ...
  Fly     1 MCCWFSLLLVAVVIYQNAFAQLLDENCKVKITYRVANGHTAITSQFMAALYN----------NSE 55

  Fly    55 HFCTGVILTNRHVLTSAHCITDKNGVMM----SPKRIVVALCASLFKTPESEEFVVDIHNMIIHP 115
            .||.|.::..::|||:|||:.|.:.|.:    :.:...:.:|..:.:...         .:|:||
  Fly    56 FFCGGSLIHKQYVLTAAHCVRDLDEVTVHLGENNRSCPIPVCKHVLRLNA---------KVILHP 111

  Fly   116 YYHRNQH-NDIAIIKLKRYVKLDGHHLAPVVLGNSSLEVGNDCKTIGGIFGVRRQRFGSFHSMLL 179
            .:|.|.. ||||:::|:|.|..:. |:.|:.:........|:...... :|..:...|:...:| 
  Fly   112 NFHGNIFLNDIALLRLEREVIFEA-HIRPICIILDEDVTSNNQNNFTA-YGWGKTEHGNISDVL- 173

  Fly   180 VNVELRPFDECLKVKKSLMAARPENEDLICVKSTEKQMCTTDFGGPLFCD----GQ----LYGI- 235
                  .|.:.:::.||:..   :|.:.||..||....|.:|.||||..:    |:    |:|| 
  Fly   174 ------SFIDLVRLPKSMCY---QNINTICAGSTSGDTCESDSGGPLIGNFVHRGKSRDILFGIT 229

  Fly   236 ALGSINCSSPDPVFFSDVSFYNSWVTKIISEA 267
            :.|...||....| ::||:.|.||:..::.|:
  Fly   230 SYGDAECSGLFGV-YTDVNAYKSWIASVVLES 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 58/244 (24%)
Tryp_SPc 38..263 CDD:304450 58/238 (24%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 59/250 (24%)
Tryp_SPc 35..256 CDD:238113 60/252 (24%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436672
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.