DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34171 and CG43336

DIOPT Version :9

Sequence 1:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:264 Identity:58/264 - (21%)
Similarity:105/264 - (39%) Gaps:48/264 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 HEPTYSHLSSYLVSLRTRK----YIHTPGDNHFCTGVILTNRHVLTSAHCITDKNGVMMSPKRIV 88
            |.|:...:.:..|:..|..    ::|:......|.|.::|||.|||:|||..|:           
  Fly    31 HSPSVPRVKNGTVASLTSSPWMAFLHSTDGRFICGGSLITNRLVLTAAHCFLDR----------- 84

  Fly    89 VALCASLFKTPESE-EFVVD------IHNMIIHPYYHRNQH-----NDIAIIKLKRYVKLDGHHL 141
            ..|.|.|.:....| |...|      |..|:...:.||:.:     .||||::|.|.|:.. .::
  Fly    85 TELVARLGEYDREEYEMCHDSYCTYRIEAMVERGFRHRHYNPMTMAYDIAILRLYRKVQYT-DNI 148

  Fly   142 AP--VVLGNSSLEVGNDCKTIGGIFGVRRQRFGSFHSMLLVNVELRPFDECLKVKKSLMAARPEN 204
            .|  :|:.....:..:....:.|....:.:..|....:..|::..:..:.|.:.....:.|    
  Fly   149 RPICIVIDPRWRKYIDSLDPLTGTGWGKTESEGDSAKLRTVDLARKHPEVCRRYATLSLTA---- 209

  Fly   205 EDLICVKSTEKQMCTTDFGGPLFCDGQL--YG-----IALGSINCSSPDPVF---FSDVSFYNSW 259
             :..|..:....:|..|.|||:   |.|  ||     :.:|..:.::...|.   |:||..|..|
  Fly   210 -NQFCAGNERSNLCNGDSGGPV---GALIPYGKSKRFVQVGIASFTNTQCVMVSVFTDVMSYVDW 270

  Fly   260 VTKI 263
            :..:
  Fly   271 ILAV 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 56/258 (22%)
Tryp_SPc 38..263 CDD:304450 56/252 (22%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 55/253 (22%)
Tryp_SPc 40..271 CDD:238113 55/250 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436663
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.