DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34171 and CG43110

DIOPT Version :9

Sequence 1:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster


Alignment Length:265 Identity:64/265 - (24%)
Similarity:106/265 - (40%) Gaps:60/265 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 CTGVILTNRHVLTSAHCITDKNGVMMSPKRIVVALCASLFKTPESEEFVVDIHNMIIHPYYHRNQ 121
            |.|.|:....|||.|||        .|.:.:.|.|.|.....|..:..|::   .|.||.|..:.
  Fly    61 CGGTIIHEDFVLTVAHC--------KSTQTLFVRLGAYNINHPTDQIRVIE---TIAHPQYSNST 114

  Fly   122 H-NDIAIIKLKRYVKLDGHHLAPVVLGNSSLEVGNDCKTIGGIFGVRRQRFGSFHSMLLVNVELR 185
            : ||||::||:|.| :...::.|:            |..:....|.:.:.:.:|......|.|..
  Fly   115 YANDIALVKLERSV-IFNLNIQPI------------CIHLDATLGKQIRYYNAFGWGRTRNAEQS 166

  Fly   186 PFDECLKVKKS-------LMAARPENEDLICVKSTEKQMCTTDFGGPLFC---------DGQLYG 234
            ...:.:.|.::       .:...|:.:. ||..:.:...|..|.||||..         |.| :|
  Fly   167 DILQRIFVNRTNPMICHLYLGMSPDPKQ-ICATTDQGDTCAGDSGGPLISKITYQGKNFDTQ-FG 229

  Fly   235 I-ALGSINCSSPDPVFFSDVSFYNSWVTKIISEAVDHTRPFIADRFSLFSFI-----------IL 287
            | :.|:..|:...  .::|||.|:.|:..|:....|.:   :..|.|...|:           ||
  Fly   230 ITSYGTRECNGVG--LYTDVSQYSGWIANIVRSKQDRS---VVSRRSNGMFLYSDCTGDSIGSIL 289

  Fly   288 MLSIV 292
            |.:||
  Fly   290 MATIV 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 53/220 (24%)
Tryp_SPc 38..263 CDD:304450 54/223 (24%)
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 53/220 (24%)
Tryp_SPc 36..257 CDD:238113 54/223 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436676
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.