DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34171 and CG43124

DIOPT Version :9

Sequence 1:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001247345.1 Gene:CG43124 / 12798282 FlyBaseID:FBgn0262587 Length:245 Species:Drosophila melanogaster


Alignment Length:292 Identity:61/292 - (20%)
Similarity:111/292 - (38%) Gaps:72/292 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLAYFLLLKIALVLPK-NITTIK---INHYHEPTYSHLSSYLVSLRTRKYIHTPGDNHFCTGVI 61
            |..|.:::|.|.|:..: :..|::   ::|......|..:.:|..:.:...:       .|.|.:
  Fly     1 MNTARWIVLCIVLMFYQGSAQTLEEDCVDHMERINGSSYAPWLAEILSDSKV-------ICAGAL 58

  Fly    62 LTNRHVLTSAHCITDKNGVMMSPKRIVVALCASLFKTPESEEFVVDIHNMIIHPYYHRNQHNDIA 126
            :.|.:|||:|.|..:.       :::.|.|.:..|........|...:..:.|  :..|..|::.
  Fly    59 INNLYVLTAASCFKEN-------EKLTVRLGSGYFDKSYENFRVTKAYFWMTH--FPANNTNNLC 114

  Fly   127 IIKLKRYVKLDGHHLAPVVLGNS--------SLEVGND-------CKTIGGIFGVRRQRFGSFHS 176
            |.:|:..|:.. .|:.|:.:..|        :.|:.|:       ||.|.|:|  .:..||    
  Fly   115 IFRLQTEVEFK-THIRPMCITKSPKSLGLATTFEIINEKPKMWYFCKNIKGLF--CKYVFG---- 172

  Fly   177 MLLVNVELRPFDECLKVKKSLMAARPENEDLICVKSTEKQMCTTDFGGPLFCDGQLYGIALGSIN 241
                                      |||:....|.|......|...|| |.....||| |...:
  Fly   173 --------------------------ENEEKWQSKPTGSPWTETISNGP-FKGLVRYGI-LSYRD 209

  Fly   242 CSSPDPVFFSDVSFYNSWVTKIISEAVDHTRP 273
            ..:.|.|:.:.:|..| |:.:|..| :|.:.|
  Fly   210 NKTYDEVYINVMSHIN-WIAQISLE-IDISTP 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 49/245 (20%)
Tryp_SPc 38..263 CDD:304450 49/239 (21%)
CG43124NP_001247345.1 Tryp_SPc 41..>133 CDD:304450 21/108 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.