DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34171 and CG43125

DIOPT Version :9

Sequence 1:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster


Alignment Length:297 Identity:67/297 - (22%)
Similarity:106/297 - (35%) Gaps:97/297 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LAYFLLLKI----ALVLPKNITTIKINHYHEPTYSHLSSYLVSLRTRKYIHTPGDNHFCTGVILT 63
            ||.|.||..    ||.|.:|.....:   ..|     :.:||.:|...     ..|..|||.::.
  Fly     7 LAVFALLLFYQGSALFLEQNCGKSSV---FSP-----APWLVKIRPEL-----SSNITCTGTLIN 58

  Fly    64 NRHVLTSAHCIT----------DKNGVMMSPKRIVVALCASLFKTPESEEFVVDIHNMIIHPYYH 118
            .|.|||:|.||.          :.:|.:.:..::            :.||  :.:...:||..|.
  Fly    59 ERFVLTAASCIDYQTELIVRLGEIDGTLQNSSKL------------QYEE--IYVARALIHRSYS 109

  Fly   119 RNQHN-DIAIIKLKR---YVKLDGHHLAPVVLGNSSLEVGNDCKTIGGIFGVRRQRFGSFHSMLL 179
            ...|. :||:::||.   |.|    ::.|:.:   .:.||...|.            .:|     
  Fly   110 SESHQYNIALLRLKTSVVYKK----NIQPICI---DVNVGKVPKA------------PTF----- 150

  Fly   180 VNVELRPFDECLKVKK-----------SLMAARPENEDLICVKS-------TEKQMCTTDFGGPL 226
             .:|.:..:|..|.|.           ||...|....|:|....       ..||:..:    .|
  Fly   151 -EIEKKKNEEPKKNKAGIMKRFLNWFLSLFGVREPRPDVILPPQPIAVGWPLTKQINES----AL 210

  Fly   227 FCDGQLYGIALGSINCSSPDPVFFSDVSFYNSWVTKI 263
            |   ..||| |...|..|...| ::||..|.:|:|.:
  Fly   211 F---HQYGI-LSHRNSESKKDV-YTDVMAYVNWITPL 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 56/262 (21%)
Tryp_SPc 38..263 CDD:304450 57/256 (22%)
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 28/122 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436677
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.