DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34171 and KLK8

DIOPT Version :9

Sequence 1:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_653088.1 Gene:KLK8 / 11202 HGNCID:6369 Length:305 Species:Homo sapiens


Alignment Length:220 Identity:58/220 - (26%)
Similarity:96/220 - (43%) Gaps:23/220 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GDNHFCTGVILTNRHVLTSAHCITDKNGVMMSPKRIVVALCASLFKTPESEEFVVDIHNMIIHPY 116
            |....|.||::....|||:|||...|..|.:....:         :..:..|..:.:...|.||.
Human    98 GQQLLCGGVLVGGNWVLTAAHCKKPKYTVRLGDHSL---------QNKDGPEQEIPVVQSIPHPC 153

  Fly   117 YHRN---QHN-DIAIIKLKRYVKLDGHHLAPVVLGNSSLEVGNDCKTIGGIFGVRRQRFGSFHSM 177
            |:.:   .|| |:.:::|:....| |..:.|:.|.:...:.|..| |:.|...|...|.....::
Human   154 YNSSDVEDHNHDLMLLQLRDQASL-GSKVKPISLADHCTQPGQKC-TVSGWGTVTSPRENFPDTL 216

  Fly   178 LLVNVELRPFDECLKVKKSLMAARPENEDLICVKSTE-KQMCTTDFGGPLFCDGQLYGI-ALGSI 240
            ....|::.|..:|.......:     .:.::|..|:: ...|..|.||||.|||.|.|| :.||.
Human   217 NCAEVKIFPQKKCEDAYPGQI-----TDGMVCAGSSKGADTCQGDSGGPLVCDGALQGITSWGSD 276

  Fly   241 NCSSPD-PVFFSDVSFYNSWVTKII 264
            .|...| |..::::..|..|:.|||
Human   277 PCGRSDKPGVYTNICRYLDWIKKII 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 54/214 (25%)
Tryp_SPc 38..263 CDD:304450 55/217 (25%)
KLK8NP_653088.1 Tryp_SPc 77..297 CDD:214473 54/214 (25%)
Tryp_SPc 78..300 CDD:238113 55/217 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.