DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34171 and CG42694

DIOPT Version :9

Sequence 1:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:279 Identity:58/279 - (20%)
Similarity:111/279 - (39%) Gaps:71/279 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ITTIKINHYHEPTYSHLSSYLV------------SLRTRKYIHTPGDNHFCTGVILTNRHVLTSA 71
            :.|.::|.:.:.:.|.:...::            .||.|.|    |.|:...|..:|:|.|:|:|
  Fly   268 VATPEVNQHLKHSLSRMGKNILLFKNCRGNSLQSKLRARIY----GPNYIGQGWFITHRFVITNA 328

  Fly    72 HCITDKNGVMMSPKRIVVALCASLFKTPESEEFVVDIHNMIIHPYYHRNQHNDIAIIKLKRYVKL 136
            ..:.:      |.:.:.|.|..:|   ...:||  .:.::..||.:..:..||||::::.:.|.:
  Fly   329 KDLPE------SAESLYVGLPGTL---RSYDEF--SVQSVFKHPEFSEDYKNDIALLRVHQRVAM 382

  Fly   137 DGHHLAPVV---------LGNSS-------LEVGNDCKTIGGIFGVRRQRFGSFHSMLLVNVELR 185
            .  ||.|:.         |..||       ::..|..:.:..|..:...|..:  :.||..:|  
  Fly   383 G--HLRPICMLLKENQQELAKSSPPISFDYVQTANRIQVVRKIDALADPRICT--NRLLKTIE-- 441

  Fly   186 PFDECLKVKKSLMAARPENEDLICVKSTEKQMCTTDFGGPL----FCDGQLYGIALGSINCSSPD 246
            |...|:.|.       ||         |.::..|.  ||.|    ...|:.:.|..|..:.|..|
  Fly   442 PNQLCVVVP-------PE---------TVQKNATR--GGILGLRMMYSGKEWLILFGISSYSHND 488

  Fly   247 PVFFSDVSFYNSWVTKIIS 265
            ...|::|..:..|:..:::
  Fly   489 IEVFTNVMEHTQWIANVVN 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 55/262 (21%)
Tryp_SPc 38..263 CDD:304450 55/256 (21%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450
Tryp_SPc 46..253 CDD:214473
Tryp_SPc 319..505 CDD:304450 48/220 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436675
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.