DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fili and RLP12

DIOPT Version :9

Sequence 1:NP_001369108.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:789 Species:Drosophila melanogaster
Sequence 2:NP_177296.2 Gene:RLP12 / 843481 AraportID:AT1G71400 Length:847 Species:Arabidopsis thaliana


Alignment Length:432 Identity:99/432 - (22%)
Similarity:159/432 - (36%) Gaps:134/432 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GAIPVLLLLLLTLVILPPETTAFCPSKCQCLGGEANSRALCVDAALEDVPIQLNPETKYINLTVN 83
            |.:|..|..|.|:|:.....::|          |..|:.   :|.:|::.:..|.....|...:.
plant   413 GEVPACLWRLNTMVLSHNSFSSF----------ENTSQE---EALIEELDLNSNSFQGPIPYMIC 464

  Fly    84 RIRTLEFSLPFYMKLEILDLSQNIIETLGS-----KNFEYQSELRTLNLSRNLVSSLHKHAFKGL 143
            ::.:|.|          ||||.|:..  ||     :||  ...::.|||..|..|......|...
plant   465 KLSSLGF----------LDLSNNLFS--GSIPSCIRNF--SGSIKELNLGDNNFSGTLPDIFSKA 515

  Fly   144 TNLLLLDLSFNRIETVHPTALSDLASLVELDLTNNNIVSLEDNCFKGMNTLEVLVFRNN------ 202
            |.|:.||:|.|::|...|.:|.:..:|..:::.:|.|..:..:..:.:.:|.||..|:|      
plant   516 TELVSLDVSHNQLEGKFPKSLINCKALELVNVESNKIKDIFPSWLESLPSLHVLNLRSNKFYGPL 580

  Fly   203 ------------RLLDVPASN-----------------------------LW-----HLHAL--- 218
                        |::|:..:|                             .|     :.|.:   
plant   581 YHRHASIGFQSLRIIDISHNNFSGTLPPYYFSNWKDMTTLTEEMDQYMTEFWRYADSYYHEMEMV 645

  Fly   219 -KSLDMSLNLVEFVRND----SFEG-------------LKELLALSVQGNVMSELDLSAFEGLIS 265
             |.:|||.   |.:|.|    .|.|             ||||..|::.||..:.:.......|..
plant   646 NKGVDMSF---ERIRRDFRAIDFSGNKINGNIPESLGYLKELRVLNLSGNAFTSVIPRFLANLTK 707

  Fly   266 LKHLDLSDNNLTMVPTQQLSKLSNLTYLNLGGNRFSQLPAVAFLNLFHLRELHLSRLDFLQRIDS 330
            |:.||:|.|.|:....|.|:.||.|:|:|...|               |.:..:.|....||...
plant   708 LETLDISRNKLSGQIPQDLAALSFLSYMNFSHN---------------LLQGPVPRGTQFQRQKC 757

  Fly   331 RAFVDNTHLQTLH--------LNNNPQLSDIPMRLFQGNPNI 364
            .:|:||..|..|.        ||...||   |..|.:...|:
plant   758 SSFLDNPGLYGLEDICRDTGALNPTSQL---PEDLSEAEENM 796

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FiliNP_001369108.1 leucine-rich repeat 75..97 CDD:275378 3/21 (14%)
leucine-rich repeat 98..121 CDD:275380 9/27 (33%)
LRR_8 120..180 CDD:404697 17/59 (29%)
leucine-rich repeat 122..145 CDD:275380 6/22 (27%)
leucine-rich repeat 146..169 CDD:275380 8/22 (36%)
LRR <161..>354 CDD:227223 59/273 (22%)
leucine-rich repeat 170..193 CDD:275380 3/22 (14%)
leucine-rich repeat 194..217 CDD:275380 9/74 (12%)
leucine-rich repeat 218..265 CDD:275380 17/67 (25%)
leucine-rich repeat 266..289 CDD:275380 9/22 (41%)
leucine-rich repeat 290..313 CDD:275380 4/22 (18%)
leucine-rich repeat 314..338 CDD:275380 7/23 (30%)
LRR_8 337..397 CDD:404697 9/36 (25%)
leucine-rich repeat 339..360 CDD:275380 8/28 (29%)
RLP12NP_177296.2 LRRNT_2 36..80 CDD:285463
LRR_8 112..170 CDD:290566
leucine-rich repeat 112..135 CDD:275380
leucine-rich repeat 136..159 CDD:275380
LRR_8 159..218 CDD:290566
leucine-rich repeat 160..183 CDD:275380
leucine-rich repeat 184..207 CDD:275380
LRR_RI 198..479 CDD:238064 20/88 (23%)
LRR_8 206..266 CDD:290566
leucine-rich repeat 208..231 CDD:275380
leucine-rich repeat 232..255 CDD:275380
leucine-rich repeat 256..279 CDD:275380
leucine-rich repeat 280..352 CDD:275380
leucine-rich repeat 304..322 CDD:275380
LRR_8 351..411 CDD:290566
leucine-rich repeat 353..376 CDD:275380
LRR_RI 374..601 CDD:238064 49/214 (23%)
leucine-rich repeat 377..400 CDD:275380
leucine-rich repeat 401..422 CDD:275380 3/8 (38%)
leucine-rich repeat 445..468 CDD:275380 3/22 (14%)
leucine-rich repeat 469..493 CDD:275380 11/37 (30%)
leucine-rich repeat 494..517 CDD:275380 6/22 (27%)
LRR_8 516..576 CDD:290566 17/59 (29%)
leucine-rich repeat 518..541 CDD:275380 8/22 (36%)
leucine-rich repeat 542..565 CDD:275380 3/22 (14%)
leucine-rich repeat 592..616 CDD:275380 3/23 (13%)
leucine-rich repeat 617..683 CDD:275380 12/68 (18%)
LRR_8 682..742 CDD:290566 21/74 (28%)
LRR_4 682..719 CDD:289563 12/36 (33%)
leucine-rich repeat 684..707 CDD:275380 5/22 (23%)
leucine-rich repeat 708..729 CDD:275380 8/20 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.