DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fili and Lrrn3

DIOPT Version :9

Sequence 1:NP_001369108.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:789 Species:Drosophila melanogaster
Sequence 2:NP_110483.2 Gene:Lrrn3 / 81514 RGDID:71066 Length:707 Species:Rattus norvegicus


Alignment Length:397 Identity:112/397 - (28%)
Similarity:191/397 - (48%) Gaps:36/397 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 IPVLLLLLLTLVILPPETTAFCPSKCQC-LGGEANSRAL--------CVDAALEDVPIQLNPETK 76
            |.|||.|.:|.::...:....||..|.| :......|::        |.|..|.:.|.:|..:|:
  Rat     8 IHVLLGLAITALVQAGDKKVDCPQLCTCEIRPWFTPRSIYMEALTVDCNDLGLLNFPARLPADTQ 72

  Fly    77 YINLTVNRIRTLEFSLPFYMKLEILDLSQNIIETLGSKNFEYQSELRTLNLSRNLVSSLHKHAFK 141
            .:.|..|.|..:|.|..|.:.|..||||||.:.::.:.|.:..|:|.::.|..|.::.|.:....
  Rat    73 ILLLQTNNIARIEHSTDFPVNLTGLDLSQNNLSSVTNINVQKMSQLLSVYLEENKLTELPEKCLY 137

  Fly   142 GLTNLLLLDLSFNRIETVHPTALSDLASLVELDLTNNNIVSLEDNCFKGMNTLEVLVFRNNRLLD 206
            ||:||..|.::.|.:..:.|.|...|.:|:.|.|.:|.:..:....|:.:..||:|:..:|.:|.
  Rat   138 GLSNLQELYVNHNLLSAISPGAFVGLHNLLRLHLNSNRLQMINSKWFEALPNLEILMLGDNPILR 202

  Fly   207 VPASNLWHLHALKSLDMSLNLVEFVRNDSFEGLKELLALSVQGNVMSELDLSAFEGLISLKHLDL 271
            :...|                        |:.|.:|.:|.:.|..::|:...|..||.:|:.:..
  Rat   203 IKDMN------------------------FQPLLKLRSLVIAGINLTEVPGDALVGLENLESISF 243

  Fly   272 SDNNLTMVPTQQLSKLSNLTYLNLGGNRFSQLPAVAFLNLFHLRELHLSRLDFLQRIDSRAFVDN 336
            .||.|..||...|.|..||.:|:|..|..:::....|.|:.||:||.::.:..|..|||.| |||
  Rat   244 YDNRLNKVPQVALQKAVNLKFLDLNKNPINRIRRGDFSNMLHLKELGINNMPELVSIDSLA-VDN 307

  Fly   337 -THLQTLHLNNNPQLSDIPMRLFQGNPNILEVYMQSNSLQTLYSAQF-PVDQLQKLYLGDNPLQC 399
             ..|:.:...|||:||.|....|...|.:..:.:.||:|..||.... .:..|:::.:..||::|
  Rat   308 LPDLRKIEATNNPRLSYIHPNAFFRLPKLESLMLNSNALSALYHGTIESLPNLKEISIHSNPIRC 372

  Fly   400 NCSLLWL 406
            :|.:.|:
  Rat   373 DCVIRWI 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FiliNP_001369108.1 leucine-rich repeat 75..97 CDD:275378 7/21 (33%)
leucine-rich repeat 98..121 CDD:275380 8/22 (36%)
LRR_8 120..180 CDD:404697 18/59 (31%)
leucine-rich repeat 122..145 CDD:275380 6/22 (27%)
leucine-rich repeat 146..169 CDD:275380 6/22 (27%)
LRR <161..>354 CDD:227223 56/193 (29%)
leucine-rich repeat 170..193 CDD:275380 5/22 (23%)
leucine-rich repeat 194..217 CDD:275380 6/22 (27%)
leucine-rich repeat 218..265 CDD:275380 9/46 (20%)
leucine-rich repeat 266..289 CDD:275380 8/22 (36%)
leucine-rich repeat 290..313 CDD:275380 6/22 (27%)
leucine-rich repeat 314..338 CDD:275380 11/24 (46%)
LRR_8 337..397 CDD:404697 16/60 (27%)
leucine-rich repeat 339..360 CDD:275380 8/20 (40%)
Lrrn3NP_110483.2 LRRNT 28..72 CDD:214470 10/43 (23%)
LRR 1 70..91 6/20 (30%)
LRR <72..355 CDD:227223 89/307 (29%)
leucine-rich repeat 72..93 CDD:275380 6/20 (30%)
LRR 2 93..114 8/20 (40%)
leucine-rich repeat 94..117 CDD:275380 8/22 (36%)
LRR 3 117..138 4/20 (20%)
leucine-rich repeat 118..141 CDD:275380 6/22 (27%)
LRR 4 141..162 6/20 (30%)
leucine-rich repeat 142..165 CDD:275380 6/22 (27%)
LRR 5 165..186 5/20 (25%)
leucine-rich repeat 166..189 CDD:275380 5/22 (23%)
LRR 6 189..210 7/44 (16%)
leucine-rich repeat 190..213 CDD:275380 8/46 (17%)
LRR 7 213..234 5/20 (25%)
leucine-rich repeat 214..237 CDD:275380 7/22 (32%)
LRR 8 237..258 7/20 (35%)
leucine-rich repeat 238..261 CDD:275380 8/22 (36%)
LRR 9 261..282 6/20 (30%)
leucine-rich repeat 262..285 CDD:275380 6/22 (27%)
LRR 10 285..304 8/18 (44%)
leucine-rich repeat 286..310 CDD:275380 11/24 (46%)
LRR 11 310..332 8/21 (38%)
leucine-rich repeat 311..333 CDD:275380 8/21 (38%)
LRR 12 335..358 5/22 (23%)
leucine-rich repeat 336..359 CDD:275378 5/22 (23%)
PCC 341..>405 CDD:188093 11/39 (28%)
leucine-rich repeat 360..372 CDD:275378 3/11 (27%)
Ig 440..513 CDD:416386
Ig strand B 440..447 CDD:409353
Ig strand C 453..458 CDD:409353
Ig strand C' 461..464 CDD:409353
Ig strand D 470..474 CDD:409353
Ig strand E 479..483 CDD:409353
Ig strand F 493..500 CDD:409353
Ig strand G 503..513 CDD:409353
fn3 526..593 CDD:394996
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8997
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.