Sequence 1: | NP_001369108.1 | Gene: | Fili / 5740472 | FlyBaseID: | FBgn0085397 | Length: | 789 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_003256.1 | Gene: | TLR3 / 7098 | HGNCID: | 11849 | Length: | 904 | Species: | Homo sapiens |
Alignment Length: | 471 | Identity: | 113/471 - (23%) |
---|---|---|---|
Similarity: | 186/471 - (39%) | Gaps: | 131/471 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 44 SKCQCLGGEANSRALCVDAALEDVPIQLNPETKYINLTVNRIRTLEFS----------------- 91
Fly 92 -----------LPFYMKLEILDLSQNIIETLGSKNFEYQSELRTLNLSRNLVSSLHKHAFKGLTN 145
Fly 146 LLLLDLSFN-----------RIETVHPTALS------------DL---ASLVELDLTNNNIVSLE 184
Fly 185 DNCFKGMNTLEVLVFRNNRL---------LDVPASNLWHLHA--------------------LKS 220
Fly 221 LDMSLNLVEFVRNDSF-------------EGLKELLALSVQG--NV------------------M 252
Fly 253 SELDLSAFEGLISLKHLDLSDNNLTMVPTQQLSKLSNLTYLNLGGNRFSQLPAV---AFLNLFHL 314
Fly 315 RELHLSRL--DFLQRIDSRAFVDNTHLQTLHLNNNPQLSDIPMRLFQGNPNILEVYMQSNSLQTL 377
Fly 378 YSAQFP-VDQLQKLYL 392 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Fili | NP_001369108.1 | leucine-rich repeat | 75..97 | CDD:275378 | 8/49 (16%) |
leucine-rich repeat | 98..121 | CDD:275380 | 7/22 (32%) | ||
LRR_8 | 120..180 | CDD:404697 | 21/85 (25%) | ||
leucine-rich repeat | 122..145 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 146..169 | CDD:275380 | 10/48 (21%) | ||
LRR | <161..>354 | CDD:227223 | 64/274 (23%) | ||
leucine-rich repeat | 170..193 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 194..217 | CDD:275380 | 6/31 (19%) | ||
leucine-rich repeat | 218..265 | CDD:275380 | 18/79 (23%) | ||
leucine-rich repeat | 266..289 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 290..313 | CDD:275380 | 9/25 (36%) | ||
leucine-rich repeat | 314..338 | CDD:275380 | 7/25 (28%) | ||
LRR_8 | 337..397 | CDD:404697 | 18/57 (32%) | ||
leucine-rich repeat | 339..360 | CDD:275380 | 4/20 (20%) | ||
TLR3 | NP_003256.1 | LRRNT | 28..50 | CDD:396168 | 6/25 (24%) |
leucine-rich repeat | 33..52 | CDD:275380 | 6/18 (33%) | ||
LRR 1 | 52..73 | 6/20 (30%) | |||
leucine-rich repeat | 53..76 | CDD:275380 | 6/22 (27%) | ||
PLN00113 | 72..>542 | CDD:215061 | 99/421 (24%) | ||
LRR 2 | 76..97 | 0/20 (0%) | |||
leucine-rich repeat | 77..100 | CDD:275380 | 1/22 (5%) | ||
LRR 3 | 100..121 | 7/23 (30%) | |||
leucine-rich repeat | 101..124 | CDD:275380 | 7/22 (32%) | ||
LRR 4 | 124..145 | 5/20 (25%) | |||
leucine-rich repeat | 125..148 | CDD:275380 | 5/22 (23%) | ||
LRR 5 | 148..168 | 7/19 (37%) | |||
leucine-rich repeat | 149..198 | CDD:275380 | 10/48 (21%) | ||
LRR 6 | 172..193 | 2/20 (10%) | |||
LRR 7 | 198..219 | 8/20 (40%) | |||
leucine-rich repeat | 199..249 | CDD:275380 | 12/49 (24%) | ||
LRR 8 | 222..244 | 4/21 (19%) | |||
LRR 9 | 249..270 | 1/20 (5%) | |||
leucine-rich repeat | 250..275 | CDD:275380 | 1/24 (4%) | ||
LRR 10 | 275..296 | 10/20 (50%) | |||
leucine-rich repeat | 276..299 | CDD:275380 | 10/22 (45%) | ||
LRR 11 | 299..320 | 2/20 (10%) | |||
leucine-rich repeat | 300..321 | CDD:275380 | 2/20 (10%) | ||
LRR 12 | 323..344 | 2/20 (10%) | |||
LRR 13 | 356..377 | 5/20 (25%) | |||
leucine-rich repeat | 357..380 | CDD:275380 | 6/22 (27%) | ||
LRR 14 | 380..400 | 8/20 (40%) | |||
leucine-rich repeat | 381..406 | CDD:275380 | 9/25 (36%) | ||
LRR 15 | 408..429 | 7/20 (35%) | |||
leucine-rich repeat | 409..432 | CDD:275380 | 7/22 (32%) | ||
LRR 16 | 432..454 | 5/21 (24%) | |||
leucine-rich repeat | 433..457 | CDD:275380 | 5/23 (22%) | ||
leucine-rich repeat | 458..481 | CDD:275380 | 7/22 (32%) | ||
LRR 17 | 465..486 | 6/20 (30%) | |||
leucine-rich repeat | 482..507 | CDD:275380 | 4/6 (67%) | ||
LRR 18 | 507..528 | ||||
leucine-rich repeat | 508..531 | CDD:275380 | |||
LRR 19 | 531..552 | ||||
leucine-rich repeat | 532..563 | CDD:275380 | |||
LRR_8 | 562..622 | CDD:404697 | |||
LRR 20 | 563..584 | ||||
leucine-rich repeat | 564..585 | CDD:275380 | |||
LRR 21 | 587..608 | ||||
leucine-rich repeat | 588..611 | CDD:275380 | |||
LRR 22 | 611..632 | ||||
leucine-rich repeat | 612..630 | CDD:275380 | |||
leucine-rich repeat | 637..659 | CDD:275380 | |||
LRRCT | 645..697 | CDD:214507 | |||
Tlr3_TMD | 698..730 | CDD:407816 | |||
TIR | 755..900 | CDD:214587 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24373 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |