DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fili and LRRN1

DIOPT Version :9

Sequence 1:NP_001369108.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:789 Species:Drosophila melanogaster
Sequence 2:NP_001311117.1 Gene:LRRN1 / 57633 HGNCID:20980 Length:716 Species:Homo sapiens


Alignment Length:675 Identity:154/675 - (22%)
Similarity:270/675 - (40%) Gaps:102/675 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 WLCGAIPVLLLLLLTLVILPPETTAFCPSKCQC-----LGGEANSRAL----CVDAALEDVPIQL 71
            ::..|..::|.||:|.:.......:.||..|.|     ...::..|..    |.|..|..:|..|
Human     6 FVIAACQLVLGLLMTSLTESSIQNSECPQLCVCEIRPWFTPQSTYREATTVDCNDLRLTRIPSNL 70

  Fly    72 NPETKYINLTVNRIRTLEFSLPFYMKLEILDLSQNIIETLGSKNFEYQSELRTLNLSRNLVSSLH 136
            :.:|:.:.|..|.|......|.....|..||.|||....:........::|.||:|..|.::.:.
Human    71 SSDTQVLLLQSNNIAKTVDELQQLFNLTELDFSQNNFTNIKEVGLANLTQLTTLHLEENQITEMT 135

  Fly   137 KHAFKGLTNLLLLDLSFNRIETVHPTALSDLASLVELDLTNNNIVSLEDNCFKGMNTLEVLVFRN 201
            .:..:.|:||..|.::.|:|.|:...|.:.|.:|:.|.|.:|.:..::...|.....||:|:...
Human   136 DYCLQDLSNLQELYINHNQISTISAHAFAGLKNLLRLHLNSNKLKVIDSRWFDSTPNLEILMIGE 200

  Fly   202 NRLLDVPASNLWHLHALKSLDMSLNLVEFVRNDSFEGLKELLALSVQGNVMSELDLSAFEGLISL 266
            |.::.:             |||           :|:.|..|.:|.:.|..::::..:|..||.||
Human   201 NPVIGI-------------LDM-----------NFKPLANLRSLVLAGMYLTDIPGNALVGLDSL 241

  Fly   267 KHLDLSDNNLTMVPTQQLSKLSNLTYLNLGGNRFSQLPAVAFLNLFHLRELHLSRLDFLQRIDSR 331
            :.|...||.|..||...|.|:.||.:|:|..|...::....|.|:..|:||.::.:..|..:|..
Human   242 ESLSFYDNKLVKVPQLALQKVPNLKFLDLNKNPIHKIQEGDFKNMLRLKELGINNMGELVSVDRY 306

  Fly   332 AFVDNTHLQTLHLNNNPQLSDIPMRLFQGNPNILEVYMQSNSLQTLYSAQF-PVDQLQKLYLGDN 395
            |..:...|..|...|||:||.|....|:..|.:..:.:.:|:|..:|.... .:..|:::.:..|
Human   307 ALDNLPELTKLEATNNPKLSYIHRLAFRSVPALESLMLNNNALNAIYQKTVESLPNLREISIHSN 371

  Fly   396 PLQCNCSLLWLWRLVTGNFEGVDPGMEHAA------GGAVAALAKEADDEELADEATAVASTDDG 454
            ||:|:|.:.|:....| |...::|.....|      |..|    ||...::.:::...:.|.|..
Human   372 PLRCDCVIHWINSNKT-NIRFMEPLSMFCAMPPEYKGHQV----KEVLIQDSSEQCLPMISHDSF 431

  Fly   455 VAALAAYIAEQHIVN--ALHTTEPSAYELATSSSNRNSGILRMDRQQIGCDIWRDKVRTRRKLLT 517
            ...|...|.....::  |:...||..|.:.                .||..|..:.:..:.||  
Human   432 PNRLNVDIGTTVFLDCRAMAEPEPEIYWVT----------------PIGNKITVETLSDKYKL-- 478

  Fly   518 MSEGEITCPAHIVTVVCAVITCLLVAMIGISVLYYLRFVKRRRKLLHERGPMRTSKSIINVHDRI 582
            .|||.:.. ::|........||:...:.|...         |...:...|.:.....::.::.:.
Human   479 SSEGTLEI-SNIQIEDSGRYTCVAQNVQGADT---------RVATIKVNGTLLDGTQVLKIYVKQ 533

  Fly   583 LQGHNPGGLGLGMSMTLGGGNHVNGLGMTLNYPHHAQTLQ---AHHHYHQAMPLQSHGGNGNHEY 644
            .:.|         |:.:..  .||...||.|....:.|::   .|..|...:|:..      |||
Human   534 TESH---------SILVSW--KVNSNVMTSNLKWSSATMKIDNPHITYTARVPVDV------HEY 581

  Fly   645 QQTTL-PQLDKLELERYLAAQTIAN 668
            ..|.| |..|      |....|::|
Human   582 NLTHLQPSTD------YEVCLTVSN 600

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FiliNP_001369108.1 leucine-rich repeat 75..97 CDD:275378 5/21 (24%)
leucine-rich repeat 98..121 CDD:275380 6/22 (27%)
LRR_8 120..180 CDD:404697 18/59 (31%)
leucine-rich repeat 122..145 CDD:275380 6/22 (27%)
leucine-rich repeat 146..169 CDD:275380 7/22 (32%)
LRR <161..>354 CDD:227223 52/192 (27%)
leucine-rich repeat 170..193 CDD:275380 5/22 (23%)
leucine-rich repeat 194..217 CDD:275380 4/22 (18%)
leucine-rich repeat 218..265 CDD:275380 11/46 (24%)
leucine-rich repeat 266..289 CDD:275380 9/22 (41%)
leucine-rich repeat 290..313 CDD:275380 6/22 (27%)
leucine-rich repeat 314..338 CDD:275380 6/23 (26%)
LRR_8 337..397 CDD:404697 15/60 (25%)
leucine-rich repeat 339..360 CDD:275380 9/20 (45%)
LRRN1NP_001311117.1 LRR_RI 13..273 CDD:238064 73/283 (26%)
leucine-rich repeat 54..73 CDD:275380 5/18 (28%)
LRR 1 73..95 5/21 (24%)
leucine-rich repeat 74..96 CDD:275380 5/21 (24%)
LRR 2 96..117 6/20 (30%)
leucine-rich repeat 97..120 CDD:275380 6/22 (27%)
LRR_8 119..179 CDD:290566 18/59 (31%)
LRR 3 120..141 5/20 (25%)
leucine-rich repeat 121..144 CDD:275380 6/22 (27%)
LRR 4 144..165 7/20 (35%)
leucine-rich repeat 145..168 CDD:275380 7/22 (32%)
LRR 5 168..189 5/20 (25%)
leucine-rich repeat 169..192 CDD:275380 5/22 (23%)
LRR 6 192..213 8/44 (18%)
leucine-rich repeat 193..216 CDD:275380 9/46 (20%)
LRR_8 216..275 CDD:290566 21/58 (36%)
LRR 7 216..237 4/20 (20%)
leucine-rich repeat 217..240 CDD:275380 6/22 (27%)
LRR_RI 240..>376 CDD:238064 40/135 (30%)
LRR 8 240..261 9/20 (45%)
leucine-rich repeat 241..264 CDD:275380 9/22 (41%)
LRR_8 263..323 CDD:290566 16/59 (27%)
LRR 9 264..285 6/20 (30%)
leucine-rich repeat 265..288 CDD:275380 6/22 (27%)
leucine-rich repeat 289..313 CDD:275380 6/23 (26%)
LRR_8 312..373 CDD:290566 15/60 (25%)
LRR 10 313..335 9/21 (43%)
leucine-rich repeat 314..335 CDD:275380 9/20 (45%)
LRR 11 338..359 3/20 (15%)
leucine-rich repeat 339..362 CDD:275378 3/22 (14%)
leucine-rich repeat 363..375 CDD:275378 4/11 (36%)
LRRCT 371..419 CDD:214507 14/52 (27%)
I-set 429..516 CDD:254352 20/114 (18%)
Ig 431..516 CDD:299845 19/112 (17%)
fn3 531..600 CDD:278470 20/91 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 691..716
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8524
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.