DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fili and lingo3a

DIOPT Version :9

Sequence 1:NP_001369108.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:789 Species:Drosophila melanogaster
Sequence 2:NP_001076323.1 Gene:lingo3a / 567293 ZFINID:ZDB-GENE-060503-54 Length:605 Species:Danio rerio


Alignment Length:401 Identity:119/401 - (29%)
Similarity:191/401 - (47%) Gaps:38/401 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LLLLLLTLVILPPETTAFCPSKCQCLGGEANSRA-LCVDAALEDVPIQLNPETKYINLTVNRIRT 87
            ||:||:|..|...::   ||.:|.|:   .:.|| :|.:..|..:|..:..:|:.::|:.|.:|.
Zfish    12 LLVLLITASITHGQS---CPQRCDCI---PHQRAVMCQNKRLGSIPGGIPADTRLLDLSCNSLRW 70

  Fly    88 LEFS-LPFYMKLEILDLSQNIIETLGSKNFEYQSELRTLNLSRNLVSSLHKHAFKGLTNLLLLDL 151
            :|:: |...::||.||||:|:|..|....|.....||.|.|..|.:..:...||..||||..|||
Zfish    71 VEYNDLSTLLRLEELDLSENLISVLEPNAFSSLLNLRVLRLRANQLKLVPMGAFSRLTNLTTLDL 135

  Fly   152 SFNRIETVHPTALSDLASLVELDLTNNNIVSLEDNCFKGMNTLEVLVFRNNRLLDVPASNLWHLH 216
            |.|::..:......||.:|..|::.:|::|.:.:..|.|:..|..|......|..:...:|.:|.
Zfish   136 SGNKLVILLDFTFQDLRNLRNLEVGDNDLVYISNKAFLGLVGLRELTIERCNLTSISGQSLSYLR 200

  Fly   217 ALKSLDMSLNLVEFVRNDSFEGLKELLALSV-QGNVMSELDLSAFEGLISLKHLDLSDNNLTMVP 280
            .|.:|.:....:..:...:|..|..|..|.: ....:..:...:|:|| :|..|.:::.|::.||
Zfish   201 GLVTLRLRYLSIASLEEQNFRKLGGLRGLEIDHWPFLEYISPHSFQGL-NLSWLSITNTNISTVP 264

  Fly   281 TQQLSKLSNLTYLNLGGNRFSQLPAVAFLNLFHLRELHLSRLDFLQRIDSRAFVDNTHLQTLHLN 345
            |..|..|.:|..|||..|..|.|.:.|..:|..|:||||...:.:.            :|...|.
Zfish   265 TGALRNLIHLASLNLSYNPISVLESWALRDLVRLKELHLVGTNLIS------------VQPYGLG 317

  Fly   346 NNPQLSDIPMRLFQGNPNILEVYMQSNSLQTLYSAQF-PVDQLQKLYLGDNPLQCNCSLLW-LWR 408
            ...|:     ||..         :.:|.|.||....| .|:.|:.|.:..|||.|:|.||| |.|
Zfish   318 GLQQI-----RLLN---------LSNNGLVTLEEGSFHSVNTLETLRVDGNPLSCDCRLLWILQR 368

  Fly   409 LVTGNFEGVDP 419
            ..|.||:|..|
Zfish   369 RKTLNFDGKSP 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FiliNP_001369108.1 leucine-rich repeat 75..97 CDD:275378 6/22 (27%)
leucine-rich repeat 98..121 CDD:275380 10/22 (45%)
LRR_8 120..180 CDD:404697 21/59 (36%)
leucine-rich repeat 122..145 CDD:275380 8/22 (36%)
leucine-rich repeat 146..169 CDD:275380 8/22 (36%)
LRR <161..>354 CDD:227223 47/193 (24%)
leucine-rich repeat 170..193 CDD:275380 6/22 (27%)
leucine-rich repeat 194..217 CDD:275380 5/22 (23%)
leucine-rich repeat 218..265 CDD:275380 9/47 (19%)
leucine-rich repeat 266..289 CDD:275380 8/22 (36%)
leucine-rich repeat 290..313 CDD:275380 9/22 (41%)
leucine-rich repeat 314..338 CDD:275380 5/23 (22%)
LRR_8 337..397 CDD:404697 14/60 (23%)
leucine-rich repeat 339..360 CDD:275380 5/20 (25%)
lingo3aNP_001076323.1 LRRNT 27..60 CDD:214470 10/35 (29%)
LRR <49..357 CDD:227223 92/334 (28%)
leucine-rich repeat 58..81 CDD:275380 6/22 (27%)
leucine-rich repeat 82..105 CDD:275380 10/22 (45%)
leucine-rich repeat 130..153 CDD:275380 8/22 (36%)
leucine-rich repeat 154..177 CDD:275380 6/22 (27%)
leucine-rich repeat 178..201 CDD:275380 5/22 (23%)
leucine-rich repeat 202..225 CDD:275380 4/22 (18%)
leucine-rich repeat 226..249 CDD:275380 5/23 (22%)
leucine-rich repeat 250..273 CDD:275380 8/22 (36%)
leucine-rich repeat 274..297 CDD:275380 9/22 (41%)
leucine-rich repeat 298..321 CDD:275380 7/34 (21%)
leucine-rich repeat 322..342 CDD:275380 7/33 (21%)
PCC 326..>392 CDD:188093 23/63 (37%)
Ig 424..492 CDD:325142
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.