DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fili and lingo1a

DIOPT Version :9

Sequence 1:NP_001369108.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:789 Species:Drosophila melanogaster
Sequence 2:XP_005174327.1 Gene:lingo1a / 564943 ZFINID:ZDB-GENE-080327-16 Length:615 Species:Danio rerio


Alignment Length:410 Identity:126/410 - (30%)
Similarity:197/410 - (48%) Gaps:52/410 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PVLLLLLLTLVILPPETTAFCPSKCQCLGGEANSRALCVDAALEDVPIQLNPETKYINLTVNRIR 86
            |:|:|:|.|  :|....|. |||:|:|...|.:  .||....|..||..:..||:.::|:.|||:
Zfish    18 PILILMLGT--VLSGSATG-CPSRCECNVQERS--VLCHRKKLMSVPEGIPSETRLLDLSKNRIK 77

  Fly    87 TL---EFSLPFYMKLEILDLSQNIIETLGSKNFEYQSELRTLNLSRNLVSSLHKHAFKGLTNLLL 148
            |:   |||.  :.:||.|:|::|.|..:....|.....|:||.|..|.:..:....|.||:||..
Zfish    78 TINPDEFSA--FPQLEELELNENTISAIEPGAFNNLYGLQTLGLRSNKLKLIQLGVFTGLSNLTK 140

  Fly   149 LDLSFNRIETVHPTALSDLASLVELDLTNNNIVSLEDNCFKGMNTLEVLVFRNNRLLDVPASNLW 213
            ||:|.|:|..:......||.:|..|::.:|::|.:....|.|:::||.|......|..||.....
Zfish   141 LDISENKIVILLDYMFQDLYNLRSLEVGDNDLVFISHRAFHGLSSLEQLTLEKCNLTSVPTEAFT 205

  Fly   214 HLHALKSLDM-SLNLVEFVRNDSFEGLKELLALSVQG-NVMSELDLSAFEGLISLKHLDLSDNNL 276
            |||:|.:|.: :|| :..:|:.||:.|..|..|.:.. ..:..:..:...|| :|..|.:::.||
Zfish   206 HLHSLVTLRLRNLN-INSIRDYSFKRLYRLKVLEIANWPYLDTMTTNCLYGL-NLTSLTITNANL 268

  Fly   277 TMVPTQQLSKLSNLTYLNLGGNRFSQLPAVAFLNLFHLRELHL--SRLDFLQRIDSRAFVDNTHL 339
            |.:|...|..|..|.:||:..|....:......:|..|:||:|  .||..::....|..   .:|
Zfish   269 TSIPYLALRHLVYLRFLNMSYNPIQMIEGNRLHDLLRLQELYLVGGRLSVIEPYSFRGL---NYL 330

  Fly   340 QTLHLNNNPQLSDIPMRLFQGNPNILEVYMQSNSLQTLYSAQF-PVDQLQKLYLGDNPLQCNCSL 403
            :.|:::                         ||.|.||..:.| .|..|:.|.|.||||.|:|.|
Zfish   331 KVLNVS-------------------------SNFLTTLEESVFHSVGNLETLALHDNPLACDCRL 370

  Fly   404 LWL----WRLVTGNFEGVDP 419
            ||:    |||   ||....|
Zfish   371 LWVFRRRWRL---NFNRQQP 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FiliNP_001369108.1 leucine-rich repeat 75..97 CDD:275378 9/24 (38%)
leucine-rich repeat 98..121 CDD:275380 7/22 (32%)
LRR_8 120..180 CDD:404697 20/59 (34%)
leucine-rich repeat 122..145 CDD:275380 8/22 (36%)
leucine-rich repeat 146..169 CDD:275380 8/22 (36%)
LRR <161..>354 CDD:227223 51/196 (26%)
leucine-rich repeat 170..193 CDD:275380 6/22 (27%)
leucine-rich repeat 194..217 CDD:275380 8/22 (36%)
leucine-rich repeat 218..265 CDD:275380 12/48 (25%)
leucine-rich repeat 266..289 CDD:275380 8/22 (36%)
leucine-rich repeat 290..313 CDD:275380 5/22 (23%)
leucine-rich repeat 314..338 CDD:275380 7/25 (28%)
LRR_8 337..397 CDD:404697 14/60 (23%)
leucine-rich repeat 339..360 CDD:275380 2/20 (10%)
lingo1aXP_005174327.1 LRRNT 34..68 CDD:214470 13/36 (36%)
LRR_RI <55..231 CDD:238064 59/178 (33%)
leucine-rich repeat 66..89 CDD:275380 9/24 (38%)
LRR_8 88..148 CDD:290566 21/59 (36%)
leucine-rich repeat 90..113 CDD:275380 7/22 (32%)
leucine-rich repeat 114..137 CDD:275380 8/22 (36%)
LRR_8 136..196 CDD:290566 18/59 (31%)
leucine-rich repeat 138..185 CDD:275380 14/46 (30%)
LRR_8 184..241 CDD:290566 19/57 (33%)
leucine-rich repeat 186..209 CDD:275380 8/22 (36%)
leucine-rich repeat 210..257 CDD:275380 12/48 (25%)
leucine-rich repeat 234..256 CDD:275380 2/21 (10%)
LRR_8 257..316 CDD:290566 17/58 (29%)
leucine-rich repeat 258..281 CDD:275380 8/22 (36%)
leucine-rich repeat 282..305 CDD:275380 5/22 (23%)
LRR_8 305..364 CDD:290566 21/86 (24%)
leucine-rich repeat 306..329 CDD:275380 7/25 (28%)
leucine-rich repeat 330..350 CDD:275380 8/44 (18%)
TPKR_C2 362..>398 CDD:301599 14/29 (48%)
I-set 421..507 CDD:254352
Ig 432..507 CDD:299845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BH3X
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.