DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fili and LRRN3

DIOPT Version :10

Sequence 1:NP_001369108.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:789 Species:Drosophila melanogaster
Sequence 2:NP_060804.3 Gene:LRRN3 / 54674 HGNCID:17200 Length:708 Species:Homo sapiens


Alignment Length:398 Identity:112/398 - (28%)
Similarity:188/398 - (47%) Gaps:38/398 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 IPVLLLLLLTLVILPPETTAFCPSKCQC----------LGGEANSRALCVDAALEDVPIQLNPET 75
            |.|||.|.:|.::...:....||..|.|          :..|| |...|.|..|...|.:|...|
Human     8 IHVLLGLAITTLVQAVDKKVDCPRLCTCEIRPWFTPRSIYMEA-STVDCNDLGLLTFPARLPANT 71

  Fly    76 KYINLTVNRIRTLEFSLPFYMKLEILDLSQNIIETLGSKNFEYQSELRTLNLSRNLVSSLHKHAF 140
            :.:.|..|.|..:|:|..|.:.|..||||||.:.::.:.|.:...:|.::.|..|.::.|.:...
Human    72 QILLLQTNNIAKIEYSTDFPVNLTGLDLSQNNLSSVTNINVKKMPQLLSVYLEENKLTELPEKCL 136

  Fly   141 KGLTNLLLLDLSFNRIETVHPTALSDLASLVELDLTNNNIVSLEDNCFKGMNTLEVLVFRNNRLL 205
            ..|:||..|.::.|.:.|:.|.|...|.:|:.|.|.:|.:..:....|..:..||:|:...|.::
Human   137 SELSNLQELYINHNLLSTISPGAFIGLHNLLRLHLNSNRLQMINSKWFDALPNLEILMIGENPII 201

  Fly   206 DVPASNLWHLHALKSLDMSLNLVEFVRNDSFEGLKELLALSVQGNVMSELDLSAFEGLISLKHLD 270
            .:...|                        |:.|..|.:|.:.|..::|:..:|..||.:|:.:.
Human   202 RIKDMN------------------------FKPLINLRSLVIAGINLTEIPDNALVGLENLESIS 242

  Fly   271 LSDNNLTMVPTQQLSKLSNLTYLNLGGNRFSQLPAVAFLNLFHLRELHLSRLDFLQRIDSRAFVD 335
            ..||.|..||...|.|:.||.:|:|..|..:::....|.|:.||:||.::.:..|..|||.| ||
Human   243 FYDNRLIKVPHVALQKVVNLKFLDLNKNPINRIRRGDFSNMLHLKELGINNMPELISIDSLA-VD 306

  Fly   336 N-THLQTLHLNNNPQLSDIPMRLFQGNPNILEVYMQSNSLQTLYSAQF-PVDQLQKLYLGDNPLQ 398
            | ..|:.:...|||:||.|....|...|.:..:.:.||:|..||.... .:..|:::.:..||::
Human   307 NLPDLRKIEATNNPRLSYIHPNAFFRLPKLESLMLNSNALSALYHGTIESLPNLKEISIHSNPIR 371

  Fly   399 CNCSLLWL 406
            |:|.:.|:
Human   372 CDCVIRWM 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FiliNP_001369108.1 LRR 71..>348 CDD:443914 77/277 (28%)
leucine-rich repeat 75..97 CDD:275378 7/21 (33%)
leucine-rich repeat 98..121 CDD:275380 8/22 (36%)
leucine-rich repeat 122..145 CDD:275380 5/22 (23%)
leucine-rich repeat 146..169 CDD:275380 7/22 (32%)
leucine-rich repeat 170..193 CDD:275380 5/22 (23%)
leucine-rich repeat 194..217 CDD:275380 5/22 (23%)
leucine-rich repeat 218..265 CDD:275380 9/46 (20%)
leucine-rich repeat 266..289 CDD:275380 8/22 (36%)
leucine-rich repeat 290..313 CDD:275380 6/22 (27%)
leucine-rich repeat 314..338 CDD:275380 11/24 (46%)
LRR_8 337..397 CDD:404697 16/60 (27%)
leucine-rich repeat 339..360 CDD:275380 8/20 (40%)
LRRN3NP_060804.3 LRRNT 28..72 CDD:214470 12/44 (27%)
LRR <69..354 CDD:443914 88/309 (28%)
LRR 1 70..91 6/20 (30%)
leucine-rich repeat 72..93 CDD:275380 6/20 (30%)
LRR 2 93..114 8/20 (40%)
leucine-rich repeat 94..117 CDD:275380 8/22 (36%)
LRR 3 117..138 4/20 (20%)
leucine-rich repeat 118..141 CDD:275380 5/22 (23%)
LRR 4 141..162 7/20 (35%)
leucine-rich repeat 142..165 CDD:275380 7/22 (32%)
LRR 5 165..186 5/20 (25%)
leucine-rich repeat 166..189 CDD:275380 5/22 (23%)
LRR 6 189..210 6/44 (14%)
leucine-rich repeat 190..213 CDD:275380 7/46 (15%)
LRR 7 213..234 5/20 (25%)
leucine-rich repeat 214..237 CDD:275380 7/22 (32%)
LRR 8 237..258 7/20 (35%)
leucine-rich repeat 238..261 CDD:275380 8/22 (36%)
LRR 9 261..282 6/20 (30%)
leucine-rich repeat 262..285 CDD:275380 6/22 (27%)
LRR 10 285..304 8/18 (44%)
leucine-rich repeat 286..310 CDD:275380 11/24 (46%)
LRR 11 310..332 8/21 (38%)
leucine-rich repeat 311..333 CDD:275380 8/21 (38%)
LRR 12 335..358 5/22 (23%)
leucine-rich repeat 336..359 CDD:275380 5/22 (23%)
PCC 341..>442 CDD:188093 11/39 (28%)
Ig 421..513 CDD:472250
Ig strand B 440..444 CDD:409353
Ig strand C 453..457 CDD:409353
Ig strand E 479..483 CDD:409353
Ig strand F 493..498 CDD:409353
Ig strand G 506..509 CDD:409353
fn3 526..593 CDD:394996
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.