DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fili and LRRC24

DIOPT Version :9

Sequence 1:NP_001369108.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:789 Species:Drosophila melanogaster
Sequence 2:NP_001019849.2 Gene:LRRC24 / 441381 HGNCID:28947 Length:513 Species:Homo sapiens


Alignment Length:586 Identity:129/586 - (22%)
Similarity:189/586 - (32%) Gaps:174/586 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PVLLLLLLTLVILPPETTAFCPSKCQCLGGEANSRALCVDAALEDVPIQLNPETKYINLTVNRIR 86
            |.||.|||.|:   |...|.||:.|:|........||    .|..||:.:.|.|:.:.|..|.|.
Human     6 PALLPLLLLLL---PLRAAGCPAACRCYSATVECGAL----RLRVVPLGIPPGTQTLFLQDNNIA 63

  Fly    87 TLEFSLPFYMKLEILDLSQNIIETLGSKNFEYQSELRTLNLSRNLVSSLHKHAFKGLTNLLLLDL 151
            .||               ...:..|.:        ||.|.|..|.:.:|...||:....||    
Human    64 RLE---------------PGALAPLAA--------LRRLYLHNNSLRALEAGAFRAQPRLL---- 101

  Fly   152 SFNRIETVHPTALSDLASLVELDLTNNNIVSLEDNCFKGMNTLEVLVFRNNRLLDVPASNLWHLH 216
                                ||.||:|.:..|....|.|:..|.||....|:|..:......||.
Human   102 --------------------ELALTSNRLRGLRSGAFVGLAQLRVLYLAGNQLARLLDFTFLHLP 146

  Fly   217 ALKSLDMSLNLVEFVRNDSFEGLKELLALSVQGNVMSELDLSAFEGLISLKHLDLSDNNLTMVPT 281
            .|:.|.:..|.:|.:.:.:..||..|..|.:..|.:..:...|.:.|.||:.|.|::|     |.
Human   147 RLQELHLQENSIELLEDQALAGLSSLALLDLSRNQLGTISREALQPLASLQVLRLTEN-----PW 206

  Fly   282 QQLSKLSNL-TYLNLGGNRF----------SQLPAVAFLNLFHLRELHLSRLDFLQRIDSRAFVD 335
            :....|..| .::..||.|.          ::.|.:|..:|..:.  |.|.:         ....
Human   207 RCDCALHWLGAWIKEGGQRLLTSRDRKIMCAEPPRLALQSLLDVS--HSSLI---------CIPP 260

  Fly   336 NTHLQTLHLNNNPQLSDIPMRLFQGNPNILEVYMQSNSLQTLYSAQFPVDQLQKLYLGDNPLQCN 400
            :.|:|.|.|..|                                            ||:: |:..
Human   261 SVHVQPLELTAN--------------------------------------------LGED-LRVA 280

  Fly   401 CSL------LWLWRLVTGNFEGVDPGMEHAAGGAVAALAKEADDE------------ELADEATA 447
            |..      |..||.|....||.........||.:......|.|.            ..|.:...
Human   281 CQASGYPQPLVTWRKVPQPREGRPRAQAQLEGGLLGLGGHSASDTGSGMLFLSNITLAHAGKYEC 345

  Fly   448 VASTDDGVAALAAYIAEQHIVNALHTTEPSAYELATSSSNRNSGILRMDRQQIGCDIWRDKVRTR 512
            .||...|    ||.:..:.:||| ...:|.........:.|.:|  ...|.:.|...:|      
Human   346 EASNAGG----AARVPFRLLVNA-SRQQPQQPAQPPPPAARPAG--SEPRPEAGSMAFR------ 397

  Fly   513 RKLLTMSEGEITCPAHIVTVVCAVITC-LLVAMIGISVLYYLRFVKRRRKLLHERGPMRTSKSII 576
                  :.|..|..|....:....:|. ||||||          .:|||:....|||.......:
Human   398 ------ALGVATQTAIAAAIALLALTALLLVAMI----------CRRRRRRKKARGPPGEGALFV 446

  Fly   577 N 577
            |
Human   447 N 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FiliNP_001369108.1 leucine-rich repeat 75..97 CDD:275378 6/21 (29%)
leucine-rich repeat 98..121 CDD:275380 1/22 (5%)
LRR_8 120..180 CDD:404697 15/59 (25%)
leucine-rich repeat 122..145 CDD:275380 8/22 (36%)
leucine-rich repeat 146..169 CDD:275380 2/22 (9%)
LRR <161..>354 CDD:227223 47/203 (23%)
leucine-rich repeat 170..193 CDD:275380 8/22 (36%)
leucine-rich repeat 194..217 CDD:275380 7/22 (32%)
leucine-rich repeat 218..265 CDD:275380 11/46 (24%)
leucine-rich repeat 266..289 CDD:275380 6/22 (27%)
leucine-rich repeat 290..313 CDD:275380 7/33 (21%)
leucine-rich repeat 314..338 CDD:275380 2/23 (9%)
LRR_8 337..397 CDD:404697 7/59 (12%)
leucine-rich repeat 339..360 CDD:275380 4/20 (20%)
LRRC24NP_001019849.2 LRR_RI 49..>158 CDD:238064 36/155 (23%)
LRR_8 <50..86 CDD:290566 13/58 (22%)
LRR 1 51..72 6/35 (17%)
leucine-rich repeat 53..75 CDD:275380 6/36 (17%)
LRR 2 75..96 8/28 (29%)
LRR_8 76..134 CDD:290566 22/81 (27%)
leucine-rich repeat 76..99 CDD:275380 8/22 (36%)
LRR 3 99..120 9/44 (20%)
leucine-rich repeat 100..123 CDD:275380 10/46 (22%)
LRR_8 123..205 CDD:290566 23/86 (27%)
LRR 4 123..144 5/20 (25%)
leucine-rich repeat 124..147 CDD:275380 7/22 (32%)
LRR 5 147..168 4/20 (20%)
leucine-rich repeat 148..171 CDD:275380 6/22 (27%)
LRR 6 171..192 4/20 (20%)
leucine-rich repeat 172..195 CDD:275380 5/22 (23%)
LRRCT 204..257 CDD:214507 12/68 (18%)
Ig 259..364 CDD:299845 26/153 (17%)
IG_like 266..362 CDD:214653 23/144 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 365..391 4/27 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.