DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fili and IGFALS

DIOPT Version :10

Sequence 1:NP_001369108.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:789 Species:Drosophila melanogaster
Sequence 2:NP_001139478.1 Gene:IGFALS / 3483 HGNCID:5468 Length:643 Species:Homo sapiens


Alignment Length:380 Identity:113/380 - (29%)
Similarity:178/380 - (46%) Gaps:45/380 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 NSRALCVDAA------LEDVPI------QLNP-------ETKYINLTVNRIRTLE----FSLPFY 95
            ||.|:..|||      |.::.:      .|.|       |.:.::|:.|.:|.::    ..||  
Human   218 NSLAVLPDAAFRGLGSLRELVLAGNRLAYLQPALFSGLAELRELDLSRNALRAIKANVFVQLP-- 280

  Fly    96 MKLEILDLSQNIIETLGSKNFEYQSELRTLNLSRNLVSSLHKHAFKGLTNLLLLDLSFNRIETVH 160
             :|:.|.|.:|:|..:....|.....||.|:||.|.|:.|.:..|.||..|.:|.||.|.|.::.
Human   281 -RLQKLYLDRNLIAAVAPGAFLGLKALRWLDLSHNRVAGLLEDTFPGLLGLRVLRLSHNAIASLR 344

  Fly   161 PTALSDLASLVELDLTNNNIVSLEDNCFKGMNTLEVLVFRNNRLLDVPASNLWHLHALKSLDMSL 225
            |....||..|.||.|.:|.|..|.:..|:|:..||||...:|:|.:|.|.....|..:..:::|.
Human   345 PRTFKDLHFLEELQLGHNRIRQLAERSFEGLGQLEVLTLDHNQLQEVKAGAFLGLTNVAVMNLSG 409

  Fly   226 NLVEFVRNDSFEGLKELLALSVQGNVMSELDLSAFEGLISLKHLDLSDNNLTMVPTQQLSKLSNL 290
            |.:..:....|.||.:|.:|.::|:.:..:....|.||..|:.|.|.||.|..:..|.|..|:.|
Human   410 NCLRNLPEQVFRGLGKLHSLHLEGSCLGRIRPHTFTGLSGLRRLFLKDNGLVGIEEQSLWGLAEL 474

  Fly   291 TYLNLGGNRFSQLPAVAFLNLFHLRELHLSR-------LDFLQRIDSRAFVDNTHLQTLHLNNNP 348
            ..|:|..|:.:.||...|..|..|..|.|||       .|.|..:....::|.:|         .
Human   475 LELDLTSNQLTHLPHRLFQGLGKLEYLLLSRNRLAELPADALGPLQRAFWLDVSH---------N 530

  Fly   349 QLSDIPMRLFQGNPNILEVYMQSNSLQTLYSAQFPVDQLQKLYLGDNPLQCNCSL 403
            :|..:|..|......:..:.:::|||:| ::.|.|  .|::|:|..||..|.|.|
Human   531 RLEALPNSLLAPLGRLRYLSLRNNSLRT-FTPQPP--GLERLWLEGNPWDCGCPL 582

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FiliNP_001369108.1 LRR 71..>348 CDD:443914 89/294 (30%)
leucine-rich repeat 75..97 CDD:275378 5/25 (20%)
leucine-rich repeat 98..121 CDD:275380 6/22 (27%)
leucine-rich repeat 122..145 CDD:275380 11/22 (50%)
leucine-rich repeat 146..169 CDD:275380 9/22 (41%)
leucine-rich repeat 170..193 CDD:275380 9/22 (41%)
leucine-rich repeat 194..217 CDD:275380 9/22 (41%)
leucine-rich repeat 218..265 CDD:275380 11/46 (24%)
leucine-rich repeat 266..289 CDD:275380 9/22 (41%)
leucine-rich repeat 290..313 CDD:275380 8/22 (36%)
leucine-rich repeat 314..338 CDD:275380 8/30 (27%)
LRR_8 337..397 CDD:404697 14/59 (24%)
leucine-rich repeat 339..360 CDD:275380 3/20 (15%)
IGFALSNP_001139478.1 LRRNT 78..116 CDD:214470
leucine-rich repeat 95..113 CDD:275380
leucine-rich repeat 114..137 CDD:275380
LRR 132..574 CDD:443914 108/370 (29%)
leucine-rich repeat 138..161 CDD:275380
leucine-rich repeat 162..185 CDD:275380
leucine-rich repeat 186..209 CDD:275380
leucine-rich repeat 210..233 CDD:275380 6/14 (43%)
leucine-rich repeat 234..257 CDD:275380 3/22 (14%)
leucine-rich repeat 258..281 CDD:275380 5/25 (20%)
leucine-rich repeat 282..305 CDD:275380 6/22 (27%)
leucine-rich repeat 306..324 CDD:275380 8/17 (47%)
leucine-rich repeat 354..377 CDD:275380 9/22 (41%)
leucine-rich repeat 378..401 CDD:275380 9/22 (41%)
leucine-rich repeat 402..423 CDD:275380 3/20 (15%)
leucine-rich repeat 426..447 CDD:275380 4/20 (20%)
leucine-rich repeat 450..473 CDD:275380 9/22 (41%)
leucine-rich repeat 474..497 CDD:275380 8/22 (36%)
leucine-rich repeat 498..519 CDD:275380 7/20 (35%)
leucine-rich repeat 522..543 CDD:275380 5/29 (17%)
leucine-rich repeat 546..565 CDD:275380 6/21 (29%)
LRRCT 574..618 CDD:214507 5/9 (56%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.