DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fili and LRRTM3

DIOPT Version :9

Sequence 1:NP_001369108.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:789 Species:Drosophila melanogaster
Sequence 2:NP_821079.3 Gene:LRRTM3 / 347731 HGNCID:19410 Length:581 Species:Homo sapiens


Alignment Length:408 Identity:94/408 - (23%)
Similarity:164/408 - (40%) Gaps:90/408 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LCGAIPVLLLLLLTLVILPPETTAFCPSKCQCLGGEANSRALCVDAALEDVPIQLNPETKYINLT 81
            |.|:...|::....|:.:.......||..|:|.|    ....|....|:::|..::.....::|.
Human     9 LSGSAVALVIAPTVLLTMLSSAERGCPKGCRCEG----KMVYCESQKLQEIPSSISAGCLGLSLR 69

  Fly    82 VNRIRTLEFSLPFYMKLEILDLSQNIIETLGSKNFEYQSELRTLNLSRNLVSSLHKHAFKGLTNL 146
            .|.::.|:::                       .|:..::|..|.|..|.:|::.::||.|:..|
Human    70 YNSLQKLKYN-----------------------QFKGLNQLTWLYLDHNHISNIDENAFNGIRRL 111

  Fly   147 LLLDLSFNRIETVHPTALSDLASLVELDLTNNNIVSLEDNCFKGMNTLEVLVFRNNRLLDVPASN 211
            ..|.||.|||..........:.:|..|||:.|.:.||....|:|:..|..|..|:|.|..:|...
Human   112 KELILSSNRISYFLNNTFRPVTNLRNLDLSYNQLHSLGSEQFRGLRKLLSLHLRSNSLRTIPVRI 176

  Fly   212 LWHLHALKSLDMSLNLVEFVRNDSFEGLKELLALSVQGNVMSELDLSAFEGLISLKHLDLSDNNL 276
            ......|:.||:..|.:..:..:.|.|:..|..|.::.|..|:|:|:.|..|:||::|.|..|.:
Human   177 FQDCRNLELLDLGYNRIRSLARNVFAGMIRLKELHLEHNQFSKLNLALFPRLVSLQNLYLQWNKI 241

  Fly   277 TMVPTQQLSKLSNLTYLNLGGNRFSQLPAVAFLNLFHLRELHLSRLDFLQRIDSRAFVDNTHLQT 341
            :::........|:|..|:|.||                              :..||        
Human   242 SVIGQTMSWTWSSLQRLDLSGN------------------------------EIEAF-------- 268

  Fly   342 LHLNNNPQLSDIPMRLFQGNPNILEVYMQSNSLQTLYSAQFPVD---QLQKLYLGDNPLQCN--- 400
                :.|.       :||..||:..:.:.||.|  .:..|..:|   .|..:.|..|..:|:   
Human   269 ----SGPS-------VFQCVPNLQRLNLDSNKL--TFIGQEILDSWISLNDISLAGNIWECSRNI 320

  Fly   401 CSLL-WLWRLVTGNFEGV 417
            |||: ||     .:|:|:
Human   321 CSLVNWL-----KSFKGL 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FiliNP_001369108.1 leucine-rich repeat 75..97 CDD:275378 3/21 (14%)
leucine-rich repeat 98..121 CDD:275380 1/22 (5%)
LRR_8 120..180 CDD:404697 20/59 (34%)
leucine-rich repeat 122..145 CDD:275380 8/22 (36%)
leucine-rich repeat 146..169 CDD:275380 7/22 (32%)
LRR <161..>354 CDD:227223 43/192 (22%)
leucine-rich repeat 170..193 CDD:275380 9/22 (41%)
leucine-rich repeat 194..217 CDD:275380 6/22 (27%)
leucine-rich repeat 218..265 CDD:275380 14/46 (30%)
leucine-rich repeat 266..289 CDD:275380 4/22 (18%)
leucine-rich repeat 290..313 CDD:275380 5/22 (23%)
leucine-rich repeat 314..338 CDD:275380 2/23 (9%)
LRR_8 337..397 CDD:404697 13/62 (21%)
leucine-rich repeat 339..360 CDD:275380 2/20 (10%)
LRRTM3NP_821079.3 LRRNT 33..61 CDD:214470 8/31 (26%)
LRR 1 63..83 4/42 (10%)
leucine-rich repeat 66..86 CDD:275380 4/42 (10%)
LRR_8 86..145 CDD:404697 20/58 (34%)
LRR 2 86..107 7/20 (35%)
leucine-rich repeat 87..110 CDD:275380 8/22 (36%)
LRR 3 110..131 7/20 (35%)
leucine-rich repeat 111..134 CDD:275380 7/22 (32%)
LRR 4 134..155 8/20 (40%)
leucine-rich repeat 135..158 CDD:275380 9/22 (41%)
PPP1R42 156..342 CDD:411060 54/234 (23%)
LRR 5 158..179 6/20 (30%)
leucine-rich repeat 159..182 CDD:275380 6/22 (27%)
LRR 6 182..203 5/20 (25%)
leucine-rich repeat 183..206 CDD:275380 6/22 (27%)
LRR 7 206..226 6/19 (32%)
leucine-rich repeat 207..230 CDD:275380 8/22 (36%)
LRR 8 230..251 5/20 (25%)
leucine-rich repeat 231..254 CDD:275380 4/22 (18%)
LRR 9 254..275 8/69 (12%)
leucine-rich repeat 255..279 CDD:275380 10/72 (14%)
LRR 10 279..300 5/22 (23%)
leucine-rich repeat 280..300 CDD:275380 4/21 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 377..408
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.