DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fili and Tsku

DIOPT Version :9

Sequence 1:NP_001369108.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:789 Species:Drosophila melanogaster
Sequence 2:NP_001009965.2 Gene:Tsku / 308843 RGDID:1359311 Length:353 Species:Rattus norvegicus


Alignment Length:320 Identity:93/320 - (29%)
Similarity:146/320 - (45%) Gaps:49/320 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LCGAIPVLLLLLLTLVILPPETTAFCPSKCQC---LGGEANSRAL----CVDAALEDVPIQLNPE 74
            ||    .|.||||.|..:  :||..|...|||   ..|..:|.:|    |.......||:.:..:
  Rat     2 LC----TLFLLLLALGTV--QTTRPCFPGCQCEEETFGLFDSFSLIRVDCSSLGPHIVPVPIPLD 60

  Fly    75 TKYINLTVNRIRTLEFSL---PFYMKLEILDLSQNIIETLGSKNFEYQSELRTLNLSRNLVSSLH 136
            |.:::|:.||:.|:..|:   |.|..|..||||.|::.::....|.....|.:|:||.|.:::|.
  Rat    61 TAHLDLSSNRLETVNESVLGGPGYTTLAGLDLSHNLLTSITPTAFSRLRYLESLDLSHNGLAALP 125

  Fly   137 KHAFKGLTNLLLLDLSFNRIETVHPTALS--DLASLVELDLTNNNIVSLEDNCFKGMNTLEVLVF 199
            ...|.. :.|..::||.||:..|..:|.:  .....:.:||::|.|                   
  Rat   126 AEVFTS-SPLSDINLSHNRLREVSISAFTTHSQGRALHVDLSHNLI------------------- 170

  Fly   200 RNNRLLDVPASNLWHLHALKSLDMSLNLVEFVRNDSFEGLKE--LLALSVQGNVMSELDLSAFEG 262
              :|||..||........::||::|.|.:..|.|     |::  |..||:.||.::.::..||.|
  Rat   171 --HRLLPYPARASLSAPTIQSLNLSWNRLRAVPN-----LRDLPLRYLSLDGNPLATINPGAFMG 228

  Fly   263 LISLKHLDLSD-NNLTMVPTQQLSKLSNLTYLNLGGN-RFSQLPAVAFLNLFHLRELHLS 320
            |..|.||.|:. ..:..:|.....:|..|..|:|.|| :.....|..|..|..|:||.||
  Rat   229 LAGLTHLSLASLQGILQLPPHGFRELPGLQVLDLSGNPKLKWAGAEVFSGLGLLQELDLS 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FiliNP_001369108.1 leucine-rich repeat 75..97 CDD:275378 8/24 (33%)
leucine-rich repeat 98..121 CDD:275380 7/22 (32%)
LRR_8 120..180 CDD:404697 17/61 (28%)
leucine-rich repeat 122..145 CDD:275380 7/22 (32%)
leucine-rich repeat 146..169 CDD:275380 7/24 (29%)
LRR <161..>354 CDD:227223 45/166 (27%)
leucine-rich repeat 170..193 CDD:275380 4/22 (18%)
leucine-rich repeat 194..217 CDD:275380 5/22 (23%)
leucine-rich repeat 218..265 CDD:275380 16/48 (33%)
leucine-rich repeat 266..289 CDD:275380 6/23 (26%)
leucine-rich repeat 290..313 CDD:275380 8/23 (35%)
leucine-rich repeat 314..338 CDD:275380 5/7 (71%)
LRR_8 337..397 CDD:404697
leucine-rich repeat 339..360 CDD:275380
TskuNP_001009965.2 LRR <39..286 CDD:227223 74/273 (27%)
LRR 1 60..80 6/19 (32%)
leucine-rich repeat 63..86 CDD:275380 7/22 (32%)
LRR 2 86..107 7/20 (35%)
leucine-rich repeat 90..110 CDD:275380 6/19 (32%)
LRR 3 110..131 7/20 (35%)
leucine-rich repeat 111..133 CDD:275380 7/22 (32%)
LRR 4 133..154 7/20 (35%)
leucine-rich repeat 134..159 CDD:275380 7/24 (29%)
leucine-rich repeat 160..186 CDD:275380 9/46 (20%)
LRR 5 160..180 9/40 (23%)
LRR 6 186..207 7/25 (28%)
leucine-rich repeat 187..205 CDD:275380 7/22 (32%)
leucine-rich repeat 208..231 CDD:275380 9/22 (41%)
LRR 7 208..228 7/19 (37%)
LRR 8 231..253 5/21 (24%)
leucine-rich repeat 232..256 CDD:275380 6/23 (26%)
LRR 9 256..277 6/20 (30%)
leucine-rich repeat 257..281 CDD:275380 8/23 (35%)
LRR 10 281..302 5/8 (63%)
leucine-rich repeat 282..305 CDD:275380 5/7 (71%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.