| Sequence 1: | NP_001369108.1 | Gene: | Fili / 5740472 | FlyBaseID: | FBgn0085397 | Length: | 789 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001008763.1 | Gene: | Lrrc66 / 289587 | RGDID: | 1306094 | Length: | 865 | Species: | Rattus norvegicus |
| Alignment Length: | 280 | Identity: | 70/280 - (25%) |
|---|---|---|---|
| Similarity: | 110/280 - (39%) | Gaps: | 71/280 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 149 LDLSFNRIETVHPTALSDLASLVELDLTNNNIVSLEDNC-----------------FKGMN-TLE 195
Fly 196 VLVFRNNRLLDVPASNLWHLHALKSLDMSLNLVEFVRNDSFEGLKELLALSVQGNVMSELDLSAF 260
Fly 261 EGLISLKHLDLSDNNLTMV----------PTQQLSKLSNLTYLNLGGNRFSQLPAVAFLNLFHL- 314
Fly 315 --------------------RELHLSR---LDFLQRIDS-----RAFVDNTHLQTLHLNNNPQLS 351
Fly 352 DI-------PMRL--FQGNP 362 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Fili | NP_001369108.1 | leucine-rich repeat | 75..97 | CDD:275378 | |
| leucine-rich repeat | 98..121 | CDD:275380 | |||
| LRR_8 | 120..180 | CDD:404697 | 9/30 (30%) | ||
| leucine-rich repeat | 122..145 | CDD:275380 | |||
| leucine-rich repeat | 146..169 | CDD:275380 | 6/19 (32%) | ||
| LRR | <161..>354 | CDD:227223 | 60/256 (23%) | ||
| leucine-rich repeat | 170..193 | CDD:275380 | 9/40 (23%) | ||
| leucine-rich repeat | 194..217 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 218..265 | CDD:275380 | 14/46 (30%) | ||
| leucine-rich repeat | 266..289 | CDD:275380 | 8/32 (25%) | ||
| leucine-rich repeat | 290..313 | CDD:275380 | 3/22 (14%) | ||
| leucine-rich repeat | 314..338 | CDD:275380 | 10/52 (19%) | ||
| LRR_8 | 337..397 | CDD:404697 | 10/35 (29%) | ||
| leucine-rich repeat | 339..360 | CDD:275380 | 6/29 (21%) | ||
| Lrrc66 | NP_001008763.1 | leucine-rich repeat | 78..99 | CDD:275380 | 6/19 (32%) |
| LRR_RI | <135..>243 | CDD:238064 | 31/108 (29%) | ||
| LRR 1 | 138..160 | 8/22 (36%) | |||
| leucine-rich repeat | 139..161 | CDD:275380 | 9/22 (41%) | ||
| LRR 2 | 161..182 | 7/20 (35%) | |||
| leucine-rich repeat | 162..185 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 164..220 | CDD:290566 | 16/55 (29%) | ||
| LRR 3 | 185..206 | 4/20 (20%) | |||
| leucine-rich repeat | 186..209 | CDD:275380 | 6/22 (27%) | ||
| LRR 4 | 209..230 | 6/20 (30%) | |||
| leucine-rich repeat | 210..235 | CDD:275380 | 6/24 (25%) | ||
| LRR 5 | 235..255 | 3/19 (16%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 463..522 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 654..749 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 840..865 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR24373 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||