DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fili and Elfn1

DIOPT Version :9

Sequence 1:NP_001369108.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:789 Species:Drosophila melanogaster
Sequence 2:NP_001099383.1 Gene:Elfn1 / 288512 RGDID:1308787 Length:829 Species:Rattus norvegicus


Alignment Length:193 Identity:53/193 - (27%)
Similarity:83/193 - (43%) Gaps:16/193 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PWLCGAIPVLLLLLLTLVILPPETTAFCPSKCQCLGGEANS--RALCV--DAALEDVPIQLNPET 75
            ||:..|...||           .........|..:.|:...  .|:|.  ....|.:|.|:|...
  Rat     9 PWVLVAAATLL-----------HACGLAQGDCWLIEGDKGFVWLAICSQNQPPYEAIPQQINNTI 62

  Fly    76 KYINLTVNRIRTLEF-SLPFYMKLEILDLSQNIIETLGSKNFEYQSELRTLNLSRNLVSSLHKHA 139
            ..:.|..||||:::: ||..:..|..|:|::|.|..:....|..|..|:.|.|..|.:.:|.:..
  Rat    63 VDLRLNENRIRSVQYASLSRFGNLTYLNLTKNEIGYIEDGAFSGQFNLQVLQLGYNRLRNLTEGM 127

  Fly   140 FKGLTNLLLLDLSFNRIETVHPTALSDLASLVELDLTNNNIVSLEDNCFKGMNTLEVLVFRNN 202
            .:||:.|..|.|..|.||.|..:|..:..::|.:||:.|.|..|....|.|:..|.|....:|
  Rat   128 LRGLSKLEYLYLQANLIEVVMASAFWECPNIVNIDLSMNRIQQLGSGTFAGLTKLSVCEIYSN 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FiliNP_001369108.1 leucine-rich repeat 75..97 CDD:275378 7/22 (32%)
leucine-rich repeat 98..121 CDD:275380 7/22 (32%)
LRR_8 120..180 CDD:404697 19/59 (32%)
leucine-rich repeat 122..145 CDD:275380 7/22 (32%)
leucine-rich repeat 146..169 CDD:275380 8/22 (36%)
LRR <161..>354 CDD:227223 12/42 (29%)
leucine-rich repeat 170..193 CDD:275380 8/22 (36%)
leucine-rich repeat 194..217 CDD:275380 3/9 (33%)
leucine-rich repeat 218..265 CDD:275380
leucine-rich repeat 266..289 CDD:275380
leucine-rich repeat 290..313 CDD:275380
leucine-rich repeat 314..338 CDD:275380
LRR_8 337..397 CDD:404697
leucine-rich repeat 339..360 CDD:275380
Elfn1NP_001099383.1 LRR <44..>186 CDD:227223 44/141 (31%)
leucine-rich repeat 65..85 CDD:275378 7/19 (37%)
LRR_8 85..144 CDD:404697 18/58 (31%)
leucine-rich repeat 86..109 CDD:275378 7/22 (32%)
leucine-rich repeat 110..133 CDD:275378 7/22 (32%)
leucine-rich repeat 134..157 CDD:275378 8/22 (36%)
leucine-rich repeat 158..171 CDD:275378 5/12 (42%)
LRRCT 190..>228 CDD:214507 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.