DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fili and Rtn4rl2

DIOPT Version :9

Sequence 1:NP_001369108.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:789 Species:Drosophila melanogaster
Sequence 2:XP_006499655.1 Gene:Rtn4rl2 / 269295 MGIID:2669796 Length:480 Species:Mus musculus


Alignment Length:396 Identity:101/396 - (25%)
Similarity:140/396 - (35%) Gaps:142/396 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PVLLLLLLTLVILPPETTAFCPSKCQCLGG------EANSRALCVDAALEDVPIQLNPETKYINL 80
            |....|||||:.| |..|..||..|.|...      :||:        ...||:.|.|.|     
Mouse    72 PASACLLLTLLAL-PSVTPSCPMLCTCYSSPPTVSCQANN--------FSSVPLSLPPST----- 122

  Fly    81 TVNRIRTLEFSLPFYMKLEILDLSQNIIETLGSKNFEYQSELRTLNLSRNLVSSLHKHAFKGLTN 145
                                                      :.|.|..||:.||....|.  .|
Mouse   123 ------------------------------------------QRLFLQNNLIRSLRPGTFG--PN 143

  Fly   146 LLLLDLSFNRIETVHPTALSDLASLVELDLTNNNIVSLEDNCFKGMNTLEVLVFRNNRLLDVPAS 210
            ||.|.|..|.:.|:||.....|.:|.||||.:|.                               
Mouse   144 LLTLWLFSNNLSTIHPGTFRHLQALEELDLGDNR------------------------------- 177

  Fly   211 NLWHLHALKSLDMSLNLVEFVRNDSFEGLKELLALSVQGNVMSELDLSAFEGLISLKHLDLSDNN 275
               ||.:|:.             |:|:||:.|.:|.:....:|.|..:.|.||:||::|.|.:|:
Mouse   178 ---HLRSLEP-------------DTFQGLERLQSLHLYRCQLSSLPGNIFRGLVSLQYLYLQENS 226

  Fly   276 LTMVPTQQLSKLSNLTYLNLGGNRFSQLPAVAFLNLFHLRE--LHLSRLDFLQRIDSRAFVDNTH 338
            |..:.....:.|:||::|.|.|||...|....|..|..|..  ||.:|   ||.:...||...:.
Mouse   227 LLHLQDDLFADLANLSHLFLHGNRLRLLTEHVFRGLGSLDRLLLHGNR---LQGVHRAAFHGLSR 288

  Fly   339 LQTLHLNNNPQLSDIPMRLFQGNPNILEVYMQSNSLQTLYSAQFPVDQLQKLYLGDNPLQCNCSL 403
            |..|:|.|| .|:.:|                ..:|..|.:.:|       |.|..||..|:|..
Mouse   289 LTILYLFNN-SLASLP----------------GEALADLPALEF-------LRLNANPWACDCRA 329

  Fly   404 --LWLW 407
              ||.|
Mouse   330 RPLWAW 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FiliNP_001369108.1 leucine-rich repeat 75..97 CDD:275378 1/21 (5%)
leucine-rich repeat 98..121 CDD:275380 0/22 (0%)
LRR_8 120..180 CDD:404697 23/59 (39%)
leucine-rich repeat 122..145 CDD:275380 7/22 (32%)
leucine-rich repeat 146..169 CDD:275380 9/22 (41%)
LRR <161..>354 CDD:227223 53/194 (27%)
leucine-rich repeat 170..193 CDD:275380 6/22 (27%)
leucine-rich repeat 194..217 CDD:275380 2/22 (9%)
leucine-rich repeat 218..265 CDD:275380 12/46 (26%)
leucine-rich repeat 266..289 CDD:275380 6/22 (27%)
leucine-rich repeat 290..313 CDD:275380 9/22 (41%)
leucine-rich repeat 314..338 CDD:275380 8/25 (32%)
LRR_8 337..397 CDD:404697 13/59 (22%)
leucine-rich repeat 339..360 CDD:275380 7/20 (35%)
Rtn4rl2XP_006499655.1 leucine-rich repeat 122..143 CDD:275380 8/69 (12%)
LRR_8 143..203 CDD:338972 25/106 (24%)
leucine-rich repeat 144..167 CDD:275380 9/22 (41%)
leucine-rich repeat 168..192 CDD:275380 13/70 (19%)
leucine-rich repeat 193..216 CDD:275380 7/22 (32%)
LRR_8 216..275 CDD:338972 21/61 (34%)
leucine-rich repeat 217..240 CDD:275380 6/22 (27%)
leucine-rich repeat 241..264 CDD:275380 9/22 (41%)
LRR_8 264..322 CDD:338972 20/84 (24%)
leucine-rich repeat 265..288 CDD:275380 8/25 (32%)
leucine-rich repeat 289..312 CDD:275380 9/39 (23%)
LRRCT 321..371 CDD:214507 7/15 (47%)
PHA03247 349..>429 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.