DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fili and LRIG1

DIOPT Version :10

Sequence 1:NP_001369108.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:789 Species:Drosophila melanogaster
Sequence 2:NP_056356.2 Gene:LRIG1 / 26018 HGNCID:17360 Length:1093 Species:Homo sapiens


Alignment Length:444 Identity:132/444 - (29%)
Similarity:199/444 - (44%) Gaps:63/444 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PVLLLLLLTLVILPPETTAF-----CPSKCQCLGG--EANSRALC-------------------- 59
            |.||||.|.|:.|.|.|.|.     |.:.|.|.|.  :...|.|.                    
Human    16 PCLLLLWLLLLRLEPVTAAAGPRAPCAAACTCAGDSLDCGGRGLAALPGDLPSWTRSLNLSYNKL 80

  Fly    60 --VD-AALEDVPIQLNPETKYIN---------------------LTVNRIRTLEFS-LPFYMKLE 99
              :| |..||:|   |.:..|:|                     |..|:||::|.| |..|:.||
Human    81 SEIDPAGFEDLP---NLQEVYLNNNELTAVPSLGAASSHVVSLFLQHNKIRSVEGSQLKAYLSLE 142

  Fly   100 ILDLSQNIIETLGSKNFEYQSELRTLNLSRNLVSSLHKHAFKGLT-NLLLLDLSFNRIETVHPTA 163
            :||||.|.|..:.:..|.:...::.|||:.|.:.:|...||.||: :||.|.||.||| |..|..
Human   143 VLDLSLNNITEVRNTCFPHGPPIKELNLAGNRIGTLELGAFDGLSRSLLTLRLSKNRI-TQLPVR 206

  Fly   164 LSDLASLVELDLTNNNIVSLEDNCFKGMNTLEVLVFRNNRLLDVPASNLWHLHALKSLDMSLNLV 228
            ...|..|.:|||..|.|..:|...|:|:|:||||..:.|.:..:.....|.|..:..|.:..|.:
Human   207 AFKLPRLTQLDLNRNRIRLIEGLTFQGLNSLEVLKLQRNNISKLTDGAFWGLSKMHVLHLEYNSL 271

  Fly   229 EFVRNDSFEGLKELLALSVQGNVMSELDLSAFEGLISLKHLDLSDNNLTMVPTQQLSKLSNLTYL 293
            ..|.:.|..||..|..|.:..|.::.:....:.....|..|.||.||||.:..:.|::||:|:.|
Human   272 VEVNSGSLYGLTALHQLHLSNNSIARIHRKGWSFCQKLHELVLSFNNLTRLDEESLAELSSLSVL 336

  Fly   294 NLGGNRFSQLPAVAFLNLFHLRELHLSRLDFLQRID--SRAFVDNTHLQTLHLNNNPQLSDIPMR 356
            .|..|..|.:...||..|..||.|.|...:....|:  |.||.....|..|.|..| ::..:..|
Human   337 RLSHNSISHIAEGAFKGLRSLRVLDLDHNEISGTIEDTSGAFSGLDSLSKLTLFGN-KIKSVAKR 400

  Fly   357 LFQGNPNILEVYMQSNSLQTL-YSAQFPVDQLQKLYLGDNPLQCNCSLLWL--W 407
            .|.|...:..:.:..|::::: :.|...:..|::|::..:...|:|.|.||  |
Human   401 AFSGLEGLEHLNLGGNAIRSVQFDAFVKMKNLKELHISSDSFLCDCQLKWLPPW 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FiliNP_001369108.1 LRR 71..>348 CDD:443914 96/301 (32%)
leucine-rich repeat 75..97 CDD:275378 10/43 (23%)
leucine-rich repeat 98..121 CDD:275380 9/22 (41%)
leucine-rich repeat 122..145 CDD:275380 9/23 (39%)
leucine-rich repeat 146..169 CDD:275380 11/22 (50%)
leucine-rich repeat 170..193 CDD:275380 9/22 (41%)
leucine-rich repeat 194..217 CDD:275380 7/22 (32%)
leucine-rich repeat 218..265 CDD:275380 9/46 (20%)
leucine-rich repeat 266..289 CDD:275380 10/22 (45%)
leucine-rich repeat 290..313 CDD:275380 8/22 (36%)
leucine-rich repeat 314..338 CDD:275380 8/25 (32%)
LRR_8 337..397 CDD:404697 11/60 (18%)
leucine-rich repeat 339..360 CDD:275380 6/20 (30%)
LRIG1NP_056356.2 leucine-rich repeat 51..69 CDD:275380 2/17 (12%)
LRR 62..414 CDD:443914 105/356 (29%)
leucine-rich repeat 70..93 CDD:275380 5/25 (20%)
leucine-rich repeat 117..140 CDD:275378 8/22 (36%)
leucine-rich repeat 141..164 CDD:275380 9/22 (41%)
leucine-rich repeat 165..197 CDD:275380 13/31 (42%)
leucine-rich repeat 213..236 CDD:275380 9/22 (41%)
leucine-rich repeat 237..260 CDD:275380 7/22 (32%)
leucine-rich repeat 261..284 CDD:275380 6/22 (27%)
leucine-rich repeat 285..308 CDD:275380 3/22 (14%)
leucine-rich repeat 309..332 CDD:275380 10/22 (45%)
leucine-rich repeat 333..356 CDD:275380 8/22 (36%)
leucine-rich repeat 357..381 CDD:275380 8/23 (35%)
leucine-rich repeat 384..405 CDD:275380 6/21 (29%)
LRR_4 408..445 CDD:463713 4/36 (11%)
leucine-rich repeat 408..431 CDD:275380 2/22 (9%)
LRRCT 442..490 CDD:214507 6/13 (46%)
Ig_3 494..581 CDD:464046
IgI_LRIG1-like 600..690 CDD:409420
Ig strand A 600..603 CDD:409420
Ig strand A' 607..611 CDD:409420
Ig strand B 614..623 CDD:409420
Ig strand C 629..634 CDD:409420
Ig strand C' 637..639 CDD:409420
Ig strand D 647..651 CDD:409420
Ig strand E 655..662 CDD:409420
Ig strand F 668..676 CDD:409420
Ig strand G 679..690 CDD:409420
I-set 693..780 CDD:400151
Ig strand B 710..714 CDD:409353
Ig strand C 723..727 CDD:409353
Ig strand E 746..750 CDD:409353
Ig strand F 760..765 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.