Sequence 1: | NP_001369108.1 | Gene: | Fili / 5740472 | FlyBaseID: | FBgn0085397 | Length: | 789 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001019790.1 | Gene: | Tsku / 244152 | MGIID: | 2443855 | Length: | 354 | Species: | Mus musculus |
Alignment Length: | 320 | Identity: | 90/320 - (28%) |
---|---|---|---|
Similarity: | 143/320 - (44%) | Gaps: | 49/320 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 17 LCGAIPVLLLLLLTLVILPPETTAFCPSKCQC---LGGEANSRAL----CVDAALEDVPIQLNPE 74
Fly 75 TKYINLTVNRIRTLEFSL---PFYMKLEILDLSQNIIETLGSKNFEYQSELRTLNLSRNLVSSLH 136
Fly 137 KHAFKGLTNLLLLDLSFNRIETVHPTALS--DLASLVELDLTNNNIVSLEDNCFKGMNTLEVLVF 199
Fly 200 RNNRLLDVPASNLWHLHALKSLDMSLNLVEFVRNDSFEGLKE--LLALSVQGNVMSELDLSAFEG 262
Fly 263 LISLKHLDLSD-NNLTMVPTQQLSKLSNLTYLNLGGN-RFSQLPAVAFLNLFHLRELHLS 320 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Fili | NP_001369108.1 | leucine-rich repeat | 75..97 | CDD:275378 | 8/24 (33%) |
leucine-rich repeat | 98..121 | CDD:275380 | 7/22 (32%) | ||
LRR_8 | 120..180 | CDD:404697 | 17/61 (28%) | ||
leucine-rich repeat | 122..145 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 146..169 | CDD:275380 | 7/24 (29%) | ||
LRR | <161..>354 | CDD:227223 | 44/166 (27%) | ||
leucine-rich repeat | 170..193 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 194..217 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 218..265 | CDD:275380 | 15/48 (31%) | ||
leucine-rich repeat | 266..289 | CDD:275380 | 6/23 (26%) | ||
leucine-rich repeat | 290..313 | CDD:275380 | 8/23 (35%) | ||
leucine-rich repeat | 314..338 | CDD:275380 | 5/7 (71%) | ||
LRR_8 | 337..397 | CDD:404697 | |||
leucine-rich repeat | 339..360 | CDD:275380 | |||
Tsku | NP_001019790.1 | LRR 1 | 60..81 | 6/20 (30%) | |
leucine-rich repeat | 63..86 | CDD:275380 | 7/22 (32%) | ||
LRR | <64..317 | CDD:227223 | 71/252 (28%) | ||
LRR 2 | 86..107 | 7/20 (35%) | |||
leucine-rich repeat | 87..110 | CDD:275380 | 7/22 (32%) | ||
LRR 3 | 110..131 | 7/20 (35%) | |||
leucine-rich repeat | 111..132 | CDD:275380 | 7/21 (33%) | ||
LRR 4 | 133..154 | 7/20 (35%) | |||
leucine-rich repeat | 134..186 | CDD:275380 | 16/72 (22%) | ||
leucine-rich repeat | 158..182 | CDD:275380 | 9/44 (20%) | ||
LRR 5 | 160..180 | 9/40 (23%) | |||
LRR 6 | 186..207 | 6/25 (24%) | |||
leucine-rich repeat | 187..205 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 208..231 | CDD:275380 | 9/22 (41%) | ||
LRR 7 | 208..228 | 7/19 (37%) | |||
LRR 8 | 231..253 | 5/21 (24%) | |||
leucine-rich repeat | 232..256 | CDD:275380 | 6/23 (26%) | ||
LRR 9 | 256..277 | 6/20 (30%) | |||
leucine-rich repeat | 257..281 | CDD:275380 | 8/23 (35%) | ||
LRR 10 | 281..302 | 5/8 (63%) | |||
leucine-rich repeat | 282..305 | CDD:275380 | 5/7 (71%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24373 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |