DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fili and Lrrc3b

DIOPT Version :9

Sequence 1:NP_001369108.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:789 Species:Drosophila melanogaster
Sequence 2:NP_666164.1 Gene:Lrrc3b / 218763 MGIID:2384996 Length:259 Species:Mus musculus


Alignment Length:165 Identity:51/165 - (30%)
Similarity:79/165 - (47%) Gaps:28/165 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 WLCGAIPVLLLL-LLTLVILPPETTAFCPSKCQCLGGEANSRALCVDAALEDVPIQLNPETKYIN 79
            ||..::.:.||| ...|:||...:.:.||..|.| .........|.:|.|:::|..|.|||    
Mouse     7 WLSRSLSMCLLLQSFVLMILCFHSASMCPKGCLC-SSSGGLNVTCSNANLKEIPRDLPPET---- 66

  Fly    80 LTVNRIRTLEFSLPFYMKLEILDLSQNIIETLGSKNFEYQSELRTLNLSRNLVSSLHKHAFKGLT 144
                               .:|.|..|.|.::.::.|:...:||.||||:|.:..:.:|||||:.
Mouse    67 -------------------VLLYLDSNQITSIPNEIFKDLHQLRVLNLSKNGIEFIDEHAFKGVA 112

  Fly   145 NLL-LLDLSFNRIETVHPTALSDLASLVELDLTNN 178
            ..| .||||.|||::||..|.::|.:...  :.||
Mouse   113 ETLQTLDLSDNRIQSVHKNAFNNLKARAR--IANN 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FiliNP_001369108.1 leucine-rich repeat 75..97 CDD:275378 1/21 (5%)
leucine-rich repeat 98..121 CDD:275380 5/22 (23%)
LRR_8 120..180 CDD:404697 26/60 (43%)
leucine-rich repeat 122..145 CDD:275380 12/22 (55%)
leucine-rich repeat 146..169 CDD:275380 12/23 (52%)
LRR <161..>354 CDD:227223 4/18 (22%)
leucine-rich repeat 170..193 CDD:275380 2/9 (22%)
leucine-rich repeat 194..217 CDD:275380
leucine-rich repeat 218..265 CDD:275380
leucine-rich repeat 266..289 CDD:275380
leucine-rich repeat 290..313 CDD:275380
leucine-rich repeat 314..338 CDD:275380
LRR_8 337..397 CDD:404697
leucine-rich repeat 339..360 CDD:275380
Lrrc3bNP_666164.1 LRRNT 33..68 CDD:214470 12/58 (21%)
LRR 1 65..86 7/43 (16%)
leucine-rich repeat 66..89 CDD:275378 6/45 (13%)
LRR_8 69..125 CDD:404697 23/55 (42%)
LRR 2 89..110 10/20 (50%)
leucine-rich repeat 90..113 CDD:275378 12/22 (55%)
LRR 3 114..135 11/20 (55%)
leucine-rich repeat 115..138 CDD:275378 12/22 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.