DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fili and Lrrc3c

DIOPT Version :10

Sequence 1:NP_001369108.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:789 Species:Drosophila melanogaster
Sequence 2:NP_001182473.1 Gene:Lrrc3c / 192852 MGIID:2684858 Length:255 Species:Mus musculus


Alignment Length:107 Identity:34/107 - (31%)
Similarity:44/107 - (41%) Gaps:25/107 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 NTLEVLVFRNNRLLDVPASNLWHLHALKSLDMSLNLVEFVRNDSFEGLKELLALSVQGNVMSELD 256
            |....|....|:|..|||....||.||:.||:|.|.:..:...:|:||                 
Mouse    58 NDTRKLYLDANQLASVPAGAFQHLPALEELDLSHNALVHLSGAAFQGL----------------- 105

  Fly   257 LSAFEGLISLKHLDLSDNNLTMVPTQQLSKLSNLTYLNLGGN 298
                ||  :|:|||||.|.|..||......|.  ..:||..|
Mouse   106 ----EG--TLRHLDLSANQLASVPVAAFVGLQ--IQVNLSAN 139

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
FiliNP_001369108.1 LRR 71..>348 CDD:443914 34/107 (32%)
leucine-rich repeat 75..97 CDD:275378
leucine-rich repeat 98..121 CDD:275380
leucine-rich repeat 122..145 CDD:275380
leucine-rich repeat 146..169 CDD:275380