| Sequence 1: | NP_001369108.1 | Gene: | Fili / 5740472 | FlyBaseID: | FBgn0085397 | Length: | 789 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_848663.1 | Gene: | RTN4RL1 / 146760 | HGNCID: | 21329 | Length: | 441 | Species: | Homo sapiens |
| Alignment Length: | 304 | Identity: | 86/304 - (28%) |
|---|---|---|---|
| Similarity: | 121/304 - (39%) | Gaps: | 67/304 - (22%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 134 SLHKHAFKGLTNLLLLD-----LSFNRIETVHPTALSDLASLVELDLTNNNIVSLEDNCFKGMNT 193
Fly 194 LEVLVFRNNRLLDVPASNLWHLHALKSLDMSLNLVEFVRNDSFEGLKELLALSVQGNVMSELDLS 258
Fly 259 AFEGLISLKHLDLSDNNLTMVPTQQLSKLSNLTYLNLGGNRFSQLPAVAFLNLFHLRELHLSRLD 323
Fly 324 FLQRIDSRAFVDNTHLQTLHLNNNPQLSDIPMRLFQGNPNILEVYMQSNSLQTLYSAQFPVDQLQ 388
Fly 389 KLYLGDNPLQCNCSL--LWLWRLVTGNFEG-------VDPGMEH 423 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Fili | NP_001369108.1 | leucine-rich repeat | 75..97 | CDD:275378 | |
| leucine-rich repeat | 98..121 | CDD:275380 | |||
| LRR_8 | 120..180 | CDD:404697 | 13/50 (26%) | ||
| leucine-rich repeat | 122..145 | CDD:275380 | 3/10 (30%) | ||
| leucine-rich repeat | 146..169 | CDD:275380 | 7/27 (26%) | ||
| LRR | <161..>354 | CDD:227223 | 59/192 (31%) | ||
| leucine-rich repeat | 170..193 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 194..217 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 218..265 | CDD:275380 | 11/46 (24%) | ||
| leucine-rich repeat | 266..289 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 290..313 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 314..338 | CDD:275380 | 8/23 (35%) | ||
| LRR_8 | 337..397 | CDD:404697 | 15/59 (25%) | ||
| leucine-rich repeat | 339..360 | CDD:275380 | 8/20 (40%) | ||
| RTN4RL1 | NP_848663.1 | leucine-rich repeat | 37..54 | CDD:275380 | 3/14 (21%) |
| LRR 1 | 55..76 | 7/22 (32%) | |||
| LRR_8 | 57..111 | CDD:316378 | 16/55 (29%) | ||
| leucine-rich repeat | 57..77 | CDD:275380 | 6/21 (29%) | ||
| LRR 2 | 77..98 | 6/20 (30%) | |||
| leucine-rich repeat | 78..101 | CDD:275380 | 7/22 (32%) | ||
| LRR 3 | 101..123 | 8/44 (18%) | |||
| leucine-rich repeat | 102..126 | CDD:275380 | 10/46 (22%) | ||
| LRR_8 | 126..185 | CDD:316378 | 21/58 (36%) | ||
| LRR 4 | 126..147 | 6/20 (30%) | |||
| leucine-rich repeat | 127..150 | CDD:275380 | 8/22 (36%) | ||
| LRR 5 | 150..171 | 6/20 (30%) | |||
| leucine-rich repeat | 151..174 | CDD:275380 | 6/22 (27%) | ||
| LRR_8 | 174..233 | CDD:316378 | 23/60 (38%) | ||
| LRR 6 | 174..195 | 8/20 (40%) | |||
| leucine-rich repeat | 175..198 | CDD:275380 | 8/22 (36%) | ||
| LRR 7 | 198..219 | 7/21 (33%) | |||
| leucine-rich repeat | 199..222 | CDD:275380 | 8/23 (35%) | ||
| LRR 8 | 222..243 | 10/44 (23%) | |||
| leucine-rich repeat | 223..246 | CDD:275380 | 11/46 (24%) | ||
| TPKR_C2 | 255..300 | CDD:326558 | 13/38 (34%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 304..382 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 397..417 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR24373 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 3.010 | |||||