DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fili and LRRC17

DIOPT Version :9

Sequence 1:NP_001369108.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:789 Species:Drosophila melanogaster
Sequence 2:NP_001026862.1 Gene:LRRC17 / 10234 HGNCID:16895 Length:441 Species:Homo sapiens


Alignment Length:405 Identity:101/405 - (24%)
Similarity:172/405 - (42%) Gaps:81/405 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 KYINLTVNRIRTLEFSLPFYMK--LEILDLSQNIIETLGSKNFEYQSELRTLNLSRNLVSSLHKH 138
            ||::.   :.|.|.:.||.:.:  |.:| |::|.|.||.:..|....:|::|:|.:|.:|.:...
Human    63 KYLDC---QERKLVYVLPGWPQDLLHML-LARNKIRTLKNNMFSKFKKLKSLDLQQNEISKIESE 123

  Fly   139 AFKGLTNLLLLDLSFNRIET------VHPTALSDLASLVELDLTNNNIVSLEDNCFKGMNTLEVL 197
            ||.||..|..|.|..|:|:.      ::...||.|              .|.||.:.....:|.|
Human   124 AFFGLNKLTTLLLQHNQIKVLTEEVFIYTPLLSYL--------------RLYDNPWHCTCEIETL 174

  Fly   198 VFRNNRLLDVPAS-NLWHLHALKSLDMSLN-LVEFVRNDSF--EGLKELL--ALSVQGN---VMS 253
            :    .:|.:|.: ||.:....:|.....| .:..::::..  |..||.|  ...|.|.   :..
Human   175 I----SMLQIPRNRNLGNYAKCESPQEQKNKKLRQIKSEQLCNEEEKEQLDPKPQVSGRPPVIKP 235

  Fly   254 ELDLSAF--EGLISLKHLDLSDNNLTMVPTQQLSKLSNLTYLNLGGNRFSQLPAVAFLNLFHLRE 316
            |:| |.|  ..:..::.||.....|..||.   :...::..|:|..|:.:||....|.::..|::
Human   236 EVD-STFCHNYVFPIQTLDCKRKELKKVPN---NIPPDIVKLDLSYNKINQLRPKEFEDVHELKK 296

  Fly   317 LHLSRLDFLQRIDSRAFVDNTHLQTLHLNNNPQLSDIPMRLFQGNPNILEVYMQSNSLQTL-YSA 380
            |:||. :.::.||..||:..|||:.|.|:|                         ||||.. |..
Human   297 LNLSS-NGIEFIDPAAFLGLTHLEELDLSN-------------------------NSLQNFDYGV 335

  Fly   381 QFPVDQLQKLYLGDNPLQCNCSL----LWLWRLVTGNFEGVD---PGMEHAAGGAVAALAKEADD 438
            ...:..|:.|:|.|||.:|:.::    .||......:|.|::   |  |...|.:|....:...:
Human   336 LEDLYFLKLLWLRDNPWRCDYNIHYLYYWLKHHYNVHFNGLECKTP--EEYKGWSVGKYIRSYYE 398

  Fly   439 EELADEATAVASTDD 453
            |...|:..|...:.|
Human   399 ECPKDKLPAYPESFD 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FiliNP_001369108.1 leucine-rich repeat 75..97 CDD:275378 6/20 (30%)
leucine-rich repeat 98..121 CDD:275380 8/22 (36%)
LRR_8 120..180 CDD:404697 17/65 (26%)
leucine-rich repeat 122..145 CDD:275380 9/22 (41%)
leucine-rich repeat 146..169 CDD:275380 8/28 (29%)
LRR <161..>354 CDD:227223 49/203 (24%)
leucine-rich repeat 170..193 CDD:275380 3/22 (14%)
leucine-rich repeat 194..217 CDD:275380 6/23 (26%)
leucine-rich repeat 218..265 CDD:275380 12/56 (21%)
leucine-rich repeat 266..289 CDD:275380 5/22 (23%)
leucine-rich repeat 290..313 CDD:275380 6/22 (27%)
leucine-rich repeat 314..338 CDD:275380 8/23 (35%)
LRR_8 337..397 CDD:404697 16/60 (27%)
leucine-rich repeat 339..360 CDD:275380 4/20 (20%)
LRRC17NP_001026862.1 leucine-rich repeat 63..81 CDD:275380 6/20 (30%)
LRR 1 82..103 8/21 (38%)
LRR_8 84..141 CDD:290566 21/57 (37%)
leucine-rich repeat 84..106 CDD:275380 8/22 (36%)
LRR_4 105..146 CDD:289563 14/40 (35%)
LRR 2 106..127 7/20 (35%)
leucine-rich repeat 107..130 CDD:275380 9/22 (41%)
LRR 3 130..151 5/20 (25%)
leucine-rich repeat 131..154 CDD:275380 5/22 (23%)
leucine-rich repeat 155..244 CDD:275380 24/107 (22%)
leucine-rich repeat 249..269 CDD:275380 5/22 (23%)
LRR_RI <267..>351 CDD:238064 29/109 (27%)
LRR 4 269..290 6/20 (30%)
leucine-rich repeat 270..293 CDD:275380 6/22 (27%)
LRR_8 272..328 CDD:290566 21/81 (26%)
LRR 5 293..314 8/21 (38%)
LRR_4 294..332 CDD:289563 18/63 (29%)
leucine-rich repeat 294..317 CDD:275380 8/23 (35%)
LRR 6 317..340 10/47 (21%)
leucine-rich repeat 318..341 CDD:275380 9/47 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.