DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fili and LOC101730277

DIOPT Version :9

Sequence 1:NP_001369108.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:789 Species:Drosophila melanogaster
Sequence 2:XP_004917450.2 Gene:LOC101730277 / 101730277 -ID:- Length:436 Species:Xenopus tropicalis


Alignment Length:438 Identity:120/438 - (27%)
Similarity:192/438 - (43%) Gaps:77/438 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 TTAFCPSKCQCLGGEANSRALCVDAALEDVPIQLNPETKYINLTVNRIRTLEFS----LPFYMKL 98
            |...||..|.|   .:.....|.:|.|.::|..|......::|..|.::.|.|.    :||   |
 Frog     6 TNTTCPGMCHC---SSEDDIQCDEAGLTNLPPDLPASAVSLDLAGNLLQILTFDAFRRVPF---L 64

  Fly    99 EILDLSQNIIETLGSKNFEYQSELRTLNLSRN-LVSSLHKHAFKGLTNLLLLDLSFNRIETVHPT 162
            |||.||||.:..|....|.....||.||||:| .::.||.|.|:||::||.||||...|..:||.
 Frog    65 EILCLSQNSLTFLYPGAFIALYNLRELNLSKNPRLTYLHAHTFRGLSHLLSLDLSHCNIFEIHPL 129

  Fly   163 ALSDLASLVELDLTNNNIVSLEDNCFKGMNTLEVLVFRNNRLLDVPASNLWHLHALKSLDMSLNL 227
            ..|.:.||..||:..|.:..: ...|:.:..:..|....|.:..:..::..:.|||:.|::..|.
 Frog   130 VFSHVLSLENLDMGFNKMRYI-PQAFRKLQNITRLSLEKNHIEAIGINSFKYQHALRDLNLRRNR 193

  Fly   228 VEFVRNDSFEGLKELLALSVQGNVMSELDLSAFEGLISLKHLDLSDNNLTMVPTQQLSKLSNLTY 292
            :..::.|:|..|.:|..|::..|.:|......|.|||.||.:.|..|.:..| ....|:|:||..
 Frog   194 IWVIQIDAFNQLNKLNVLNLGHNSISHFPNQLFSGLIQLKIMHLEANKIGSV-NCSFSRLTNLKK 257

  Fly   293 LNLGGNRFSQLPAVAFLNLFHLRELHLSRLDFLQRIDSRAFVDNTHLQTLHLNNNPQLSDIPMRL 357
            |:|..|:.:.:...||.:|.|::.||||:                        ||  |:.:|..|
 Frog   258 LHLNNNQITWITRNAFGSLKHVQLLHLSK------------------------NN--LTSMPSHL 296

  Fly   358 FQGNPNILEVYMQSNSLQTLYSAQFPVDQLQKLYLGDNPLQCNCSLLWLWRLVTGNFEGVDPGME 422
            |...|                       :|:.::|..||..|:||:.|:.|.:. :::|:..|| 
 Frog   297 FSSMP-----------------------KLRYVFLSFNPWSCDCSMSWIARWLV-SYDGMIQGM- 336

  Fly   423 HAAGGAVAALAKEADDEELADEATAVASTDDGVAALAAYIAEQHIVNA 470
            |...|             ||.::.:.....:|:..|.....|...|.:
 Frog   337 HCMYG-------------LAHQSASHVYMQNGIMCLQEGFTEGDCVES 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FiliNP_001369108.1 leucine-rich repeat 75..97 CDD:275378 6/25 (24%)
leucine-rich repeat 98..121 CDD:275380 10/22 (45%)
LRR_8 120..180 CDD:404697 28/60 (47%)
leucine-rich repeat 122..145 CDD:275380 13/23 (57%)
leucine-rich repeat 146..169 CDD:275380 10/22 (45%)
LRR <161..>354 CDD:227223 49/192 (26%)
leucine-rich repeat 170..193 CDD:275380 5/22 (23%)
leucine-rich repeat 194..217 CDD:275380 2/22 (9%)
leucine-rich repeat 218..265 CDD:275380 13/46 (28%)
leucine-rich repeat 266..289 CDD:275380 7/22 (32%)
leucine-rich repeat 290..313 CDD:275380 7/22 (32%)
leucine-rich repeat 314..338 CDD:275380 4/23 (17%)
LRR_8 337..397 CDD:404697 10/59 (17%)
leucine-rich repeat 339..360 CDD:275380 6/20 (30%)
LOC101730277XP_004917450.2 LRRNT 10..37 CDD:396168 8/29 (28%)
LRR_8 42..97 CDD:404697 22/57 (39%)
leucine-rich repeat 42..63 CDD:275378 4/20 (20%)
leucine-rich repeat 64..87 CDD:275380 10/22 (45%)
leucine-rich repeat 88..136 CDD:275380 23/47 (49%)
LRR <122..>293 CDD:227223 51/198 (26%)
leucine-rich repeat 137..159 CDD:275380 5/22 (23%)
leucine-rich repeat 160..183 CDD:275380 2/22 (9%)
leucine-rich repeat 184..207 CDD:275380 6/22 (27%)
leucine-rich repeat 208..231 CDD:275380 7/22 (32%)
leucine-rich repeat 232..254 CDD:275380 7/22 (32%)
leucine-rich repeat 255..278 CDD:275380 7/22 (32%)
leucine-rich repeat 279..302 CDD:275380 11/71 (15%)
TPKR_C2 311..>326 CDD:417692 7/14 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D187891at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.